Knowledge

Homeobox

Source 📝

865: 755: 1110: 31: 1091:. It is accepted that the three major animal ANTP-class clusters, Hox, ParaHox, and NK (MetaHox), are the result of segmental duplications. A first duplication created MetaHox and ProtoHox, the latter of which later duplicated into Hox and ParaHox. The clusters themselves were created by tandem duplications of a single ANTP-class homeobox gene. Gene duplication followed by 1206:
LIM genes (named after the initial letters of the names of three proteins where the characteristic domain was first identified) encode two 60 amino acid cysteine and histidine-rich LIM domains and a homeodomain. The LIM domains function in protein-protein interactions and can bind zinc molecules. LIM
972:
residues in the center of the recognition helix aid in stabilizing the helix packing. Homeodomain proteins show a preference for the DNA sequence 5'-TAAT-3'; sequence-independent binding occurs with significantly lower affinity. The specificity of a single homeodomain protein is usually not enough to
1141:
and colleagues in 1984. The main interest in this set of genes stems from their unique behavior and arrangement in the genome. Hox genes are typically found in an organized cluster. The linear order of Hox genes within a cluster is directly correlated to the order they are expressed in both time and
1029:
are highly conserved developmental master regulators with tight tissue-specific, spatiotemporal control. These genes are known to be dysregulated in several cancers and are often controlled by DNA methylation. The regulation of Hox genes is highly complex and involves reciprocal interactions, mostly
1286:
As in animals, the plant homeobox genes code for the typical 60 amino acid long DNA-binding homeodomain or in case of the TALE (three amino acid loop extension) homeobox genes for an atypical homeodomain consisting of 63 amino acids. According to their conserved intron–exon structure and to unique
1186:
cell (EC) migration by upregulating MMP14 and uPAR. Conversely, HoxD10 and HoxA5 have the opposite effect of suppressing EC migration and angiogenesis, and stabilizing adherens junctions by upregulating TIMP1/downregulating uPAR and MMP14, and by upregulating Tsp2/downregulating VEGFR2, Efna1,
1191:
growth. HoxA5 has far-reaching effects on gene expression, causing ~300 genes to become upregulated upon its induction in breast cancer cell lines. HoxA5 protein transduction domain overexpression prevents inflammation shown by inhibition of TNFalpha-inducible monocyte binding to HUVECs.
989:
due to the DNA binding properties of the conserved HTH motif. Homeodomain proteins are considered to be master control genes, meaning that a single protein can regulate expression of many target genes. Homeodomain proteins direct the formation of the body axes and body structures during
973:
recognize specific target gene promoters, making cofactor binding an important mechanism for controlling binding sequence specificity and target gene expression. To achieve higher target specificity, homeodomain proteins form complexes with other transcription factors to recognize the
860:
Helix 1 Helix 2 Helix 3/4 ______________ __________ _________________ RRRKRTAYTRYQLLELEKEFHFNRYLTRRRRIELAHSLNLTERHIKIWFQNRRMKWKKEN ....|....|....|....|....|....|....|....|....|....|....|....| 10 20 30 40 50
1182:, and disease by orchestrating changes in matrix degradation, integrins, and components of the ECM. HoxA5 is implicated in atherosclerosis. HoxD3 and HoxB3 are proinvasive, angiogenic genes that upregulate b3 and a5 integrins and Efna1 in ECs, respectively. HoxA3 induces 1078:
Phylogenetic analysis of homeobox gene sequences and homeodomain protein structures suggests that the last common ancestor of plants, fungi, and animals had at least two homeobox genes. Molecular evidence shows that some limited number of Hox genes have existed in the
1287:
codomain architectures they have been grouped into 14 distinct classes: HD-ZIP I to IV, BEL, KNOX, PLINC, WOX, PHD, DDT, NDX, LD, SAWADEE and PINTOX. Conservation of codomains suggests a common eukaryotic ancestry for TALE and non-TALE homeodomain proteins.
1264:
motifs and also binds DNA. The two domains are linked by a flexible loop that is long enough to stretch around the DNA helix, allowing the two domains to bind on opposite sides of the target DNA, collectively covering an eight-base segment with
1269:
5'-ATGCAAAT-3'. The individual domains of POU proteins bind DNA only weakly, but have strong sequence-specific affinity when linked. The POU domain itself has significant structural similarity with repressors expressed in
952:
with the C-terminal recognition helix aligning in the DNA's major groove and the unstructured peptide "tail" at the N-terminus aligning in the minor groove. The recognition helix and the inter-helix loops are rich in
712:
to regulate expression of target genes. Homeodomain proteins regulate gene expression and cell differentiation during early embryonic development, thus mutations in homeobox genes can cause developmental disorders.
1095:
is responsible for the many homeobox genes found in eukaryotes. Comparison of homeobox genes and gene clusters has been used to understand the evolution of genome structure and body morphology throughout metazoans.
939:
interference of the beta-carbon with the main chain: for cro and repressor proteins the glycine appears to be mandatory, whereas for many of the homeotic and other DNA-binding proteins the requirement is relaxed.
1153:. For example, when one gene is lost the segment develops into a more anterior one, while a mutation that leads to a gain of function causes a segment to develop into a more posterior one. Famous examples are 1221:
Most Pax genes contain a homeobox and a paired domain that also binds DNA to increase binding specificity, though some Pax genes have lost all or part of the homeobox sequence. Pax genes function in embryo
3675:
Carrasco AE, McGinnis W, Gehring WJ, De Robertis EM (June 1984). "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes".
2959:
Carrasco AE, McGinnis W, Gehring WJ, De Robertis EM (June 1984). "Cloning of an X. laevis gene expressed during early embryogenesis coding for a peptide region homologous to Drosophila homeotic genes".
4970: 868:
The vnd/NK-2 homeodomain-DNA complex. Helix 3 of the homeodomain binds in the major groove of the DNA and the N-terminal arm binds in the minor groove, in analogy with other homeodomain-DNA complexes.
1207:
domain proteins are found in both the cytosol and the nucleus. They function in cytoskeletal remodeling, at focal adhesion sites, as scaffolds for protein complexes, and as transcription factors.
666:
long, that regulates large-scale anatomical features in the early stages of embryonic development. Mutations in a homeobox may change large-scale anatomical features of the full-grown organism.
2498:
Billeter M, Qian YQ, Otting G, Müller M, Gehring W, Wüthrich K (December 1993). "Determination of the nuclear magnetic resonance solution structure of an Antennapedia homeodomain-DNA complex".
4963: 2688:
Materials for the study of variation, treated with especial regard to discontinuity in the origin of species William Bateson 1861–1926. London : Macmillan 1894 xv, 598 p
5892: 3770:
Fromental-Ramain C, Warot X, Messadecq N, LeMeur M, Dollé P, Chambon P (October 1996). "Hoxa-13 and Hoxd-13 play a crucial role in the patterning of the limb autopod".
1187:
Hif1alpha and COX-2, respectively. HoxA5 also upregulates the tumor suppressor p53 and Akt1 by downregulation of PTEN. Suppression of HoxA5 has been shown to attenuate
785:
revealed that this gene contained a 180 base pair sequence that encoded a DNA binding domain, which William McGinnis termed the "homeobox". The existence of additional
775:
by isolating the gene responsible for a homeotic transformation where legs grow from the head instead of the expected antennae. Walter Gehring identified a gene called
10382: 4956: 181: 6391: 2849:
McGinnis W, Levine MS, Hafen E, Kuroiwa A, Gehring WJ (1984). "A conserved DNA sequence in homoeotic genes of the Drosophila Antennapedia and bithorax complexes".
2902:"Structural relationships among genes that control development: sequence homology between the Antennapedia, Ultrabithorax, and fushi tarazu loci of Drosophila" 1174:
clusters are partially redundant in function, but have also acquired several derived functions. For example, HoxA and HoxD specify segment identity along the
931:, homeodomain proteins, etc.). One of the principal differences between HTH motifs in these different proteins arises from the stereochemical requirement for 8598: 4257:
Rhoads K, Arderiu G, Charboneau A, Hansen SL, Hoffman W, Boudreau N (2005). "A role for Hox A5 in regulating angiogenesis and vascular patterning".
7276: 6298: 6293: 6288: 1042:
complexes to maintain the expression of Hox genes after the down-regulation of the pair-rule and gap genes that occurs during larval development.
5937: 896:
via a number of hydrogen bonds and hydrophobic interactions, as well as indirect interactions via water molecules, which occur between specific
727:—replacement of the antenna on the head of a fruit fly with legs. The "homeo-" prefix in the words "homeobox" and "homeodomain" stems from this 5922: 5608: 3719:
Schneuwly S, Klemenz R, Gehring WJ (1987). "Redesigning the body plan of Drosophila by ectopic expression of the homoeotic gene Antennapedia".
1242:
is a master regulator of eye development, such that the gene is necessary for development of the optic vesicle and subsequent eye structures.
6431: 2088: 1768: 4572:"Analysis of TALE superclass homeobox genes (MEIS, PBC, KNOX, Iroquois, TGIF) reveals a novel domain conserved between plants and animals" 3090: 10948: 10226: 10210: 5029: 2828: 1131:
genes that determine the identity of embryonic regions along the anterior-posterior axis. The first vertebrate Hox gene was isolated in
915:. Through the HTH motif, they share limited sequence similarity and structural similarity to prokaryotic transcription factors, such as 6283: 1824: 1820: 8999: 8994: 8989: 8984: 8979: 6068: 6061: 6056: 6044: 6039: 6034: 6029: 6024: 5952: 4514: 3040: 2180: 1914: 1910: 1707: 1703: 105: 1630:
Human TALE (Three Amino acid Loop Extension) homeobox genes for an "atypical" homeodomain consist of 63 rather than 60 amino acids:
9948: 8071: 4619:
Derelle R, Lopez P, Le Guyader H, Manuel M (2007). "Homeodomain proteins belong to the ancestral molecular toolkit of eukaryotes".
2385: 2361: 2341: 2333: 2214: 1836: 1832: 1828: 1780: 1627:. Dlx genes are involved in the development of the nervous system and of limbs. They are considered a subset of the NK-like genes. 2660: 9159: 9154: 9104: 9094: 9074: 9059: 9039: 8964: 8944: 8086: 8081: 6747: 3069: 2322: 2306: 2226: 2222: 2196: 2184: 2076: 2044: 2008: 2000: 1981: 1973: 1949: 1941: 1858: 1854: 1850: 1846: 1663: 1596:. The NK-like (NKL) genes, some of which are considered "MetaHox", are grouped with Hox-like genes into a large ANTP-like group. 10904: 8315: 8273: 8268: 8263: 8201: 8035: 7823: 7774: 7769: 5816: 5806: 2373: 2369: 2365: 2318: 2270: 2200: 2168: 2060: 2048: 2036: 2032: 2028: 2024: 2020: 2016: 2012: 1922: 1900: 1754: 1750: 1742: 1722: 1683: 1577: 1573: 1561: 1557: 4743: 1066:. Duplication of homeobox genes can produce new body segments, and such duplications are likely to have been important in the 4852: 4825: 3276: 892:
helix is roughly perpendicular to the axes established by the first two. It is this third helix that interacts directly with
833:
studies detailing the evolutionary relationship between homeobox-containing genes showed that these genes are present in all
129: 201: 10869: 9711: 5603: 5175: 1167:, which can cause the development of legs instead of antennae and the development of a duplicated thorax, respectively. 10714: 10442: 9980: 8879: 6966: 2464: 923:. The HTH motif shows some sequence similarity but a similar structure in a wide range of DNA-binding proteins (e.g., 10414: 6424: 6419: 6347: 6337: 5214: 5204: 5039: 4038:"The homeobox transcription factor Hox D3 promotes integrin alpha5beta1 expression and function during angiogenesis" 10671: 10457: 10452: 6342: 6256: 4915: 3372:"Pre-bilaterian origins of the Hox cluster and the Hox code: evidence from the sea anemone, Nematostella vectensis" 818: 10928: 9278: 6554: 6544: 5145: 5024: 3282: 3218:
Bhatlekar S, Fields JZ, Boman BM (August 2014). "HOX genes and their role in the development of human cancers".
10938: 6909: 6549: 6244: 2286: 829:
and William McGinnis revealed that numerous genes from a variety of species contained the homeobox. Subsequent
10848: 4346:"Restoring transcription factor HoxA5 expression inhibits the growth of experimental hemangiomas in the brain" 189: 10699: 10191: 10186: 9337: 6249: 3263:"The Role of RNAi and Noncoding RNAs in Polycomb Mediated Control of Gene Expression and Genomic Programming" 10286: 8622: 6772: 6325: 6315: 4765:
Kraus P, Lufkin T (July 2006). "Dlx homeobox gene control of mammalian limb and craniofacial development".
4535:
Walther C, Gruss P (December 1991). "Pax-6, a murine paired box gene, is expressed in the developing CNS".
3005:"A homologous protein-coding sequence in Drosophila homeotic genes and its conservation in other metazoans" 4906: 4218:"HOXA3 induces cell migration in endothelial and epithelial cells promoting angiogenesis and wound repair" 49:. The recognition helix and unstructured N-terminus are bound in the major and minor grooves respectively. 10666: 8791: 8786: 8337: 6414: 6332: 6320: 5396: 2188: 2004: 885: 110: 10858: 10724: 10556: 6527: 5525: 3569:"Evolution of Homeobox Gene Clusters in Animals: The Giga-Cluster and Primary vs. Secondary Clustering" 794: 185: 765:
mutant phenotype exhibit homeotic transformation of the antennae into leg-like structures on the head.
10551: 9943: 6824: 6809: 6792: 6787: 6782: 6777: 6688: 6663: 6539: 6451: 6441: 5598: 5071: 924: 142: 4948: 10933: 9685: 9320: 8836: 8409: 8248: 7183: 7178: 7163: 6638: 6613: 6495: 6446: 6239: 5630: 5096: 4928: 4844: 1039: 995: 4899:
The Homeodomain Resource (National Human Genome Research Institute, National Institutes of Health)
3120:
Corsetti MT, Briata P, Sanseverino L, Daga A, Airoldi I, Simeone A, et al. (September 1992).
742:
and segmentation proteins, but is now known to be well-conserved in many other animals, including
10943: 10792: 10729: 10704: 10587: 10507: 10050: 8091: 7408: 6522: 6510: 4434:
Kadrmas JL, Beckerle MC (November 2004). "The LIM domain: from the cytoskeleton to the nucleus".
2230: 1257: 1043: 1035: 966: 41: 10777: 10676: 10661: 10630: 10531: 10181: 8228: 8223: 6618: 6515: 6310: 6271: 5334: 4983: 3098: 2736:
Scott MP, Tamkun JW, Hartzell GW (July 1989). "The structure and function of the homeodomain".
2282: 1223: 1007: 3891:"Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis" 3370:
Ryan JF, Mazza ME, Pang K, Matus DQ, Baxevanis AD, Martindale MQ, et al. (January 2007).
3171:"Flow-Dependent Epigenetic DNA Methylation in Endothelial Gene Expression and Atherosclerosis" 2820: 1490: 1438: 1382: 1322: 10888: 10782: 10709: 10608: 10546: 10541: 10472: 10407: 10173: 9733: 6532: 6468: 6463: 6276: 5352: 4904:
HomeoDB: a database of homeobox genes diversity. Zhong YF, Butts T, Holland PWH, since 2008.
1138: 1062:
changes in body segment identity, such as the Antennapedia and Bithorax mutant phenotypes in
826: 659: 4836: 10797: 10640: 10635: 10517: 10512: 10499: 9754: 9746: 7584: 7066: 6591: 6586: 6581: 6261: 6144: 4979: 4731: 3940:"The role of epigenetics in the endothelial cell shear stress response and atherosclerosis" 3728: 3631: 3429:
Garcia-Fernàndez J (December 2005). "The genesis and evolution of homeobox gene clusters".
3383: 3316: 2913: 2858: 1328: 1092: 986: 822: 802: 701: 168: 4478: 3305:"Did homeodomain proteins duplicate before the origin of angiosperms, fungi, and metazoa?" 3004: 723:
to describe the outright replacement of a discrete body part with another body part, e.g.
8: 10893: 10068: 9772: 9468: 7671: 6876: 6458: 6436: 6409: 6371: 6305: 4837: 4722:
Coulier F, Popovici C, Villet R, Birnbaum D (15 December 2000). "MetaHox gene clusters".
4126:
Chen Y, Xu B, Arderiu G, Hashimoto T, Young WL, Boudreau N, et al. (November 2004).
806: 4735: 3732: 3635: 3387: 3320: 2917: 2862: 10582: 9606: 4790: 4699: 4672: 4644: 4506: 4459: 4370: 4345: 4321: 4296: 4193: 4168: 4144: 4127: 4103: 4078: 4013: 3988: 3964: 3939: 3915: 3890: 3830: 3752: 3701: 3657: 3549: 3501: 3476: 3454: 3406: 3371: 3334: 3243: 3195: 3170: 3032: 2985: 2882: 2788: 2718: 2668: 2564: 2539: 1553: 1266: 1231: 1171: 1150: 974: 854: 4862:
Ogishima S, Tanaka H (January 2007). "Missing link in the evolution of Hox clusters".
4596: 4571: 4184: 3644: 3619: 3146: 3121: 3062: 2936: 2901: 2797: 2772: 1178:
axis. Specific members of the Hox family have been implicated in vascular remodeling,
10843: 10623: 10618: 10527: 9188: 9179: 8816: 7764: 6505: 6500: 4879: 4848: 4821: 4814: 4782: 4747: 4704: 4636: 4632: 4601: 4552: 4498: 4494: 4451: 4416: 4375: 4326: 4274: 4239: 4198: 4149: 4108: 4059: 4018: 3969: 3920: 3871: 3822: 3787: 3744: 3693: 3689: 3649: 3600: 3541: 3506: 3446: 3411: 3352: 3347: 3304: 3272: 3235: 3200: 3151: 3024: 3020: 2977: 2973: 2941: 2874: 2802: 2753: 2749: 2714: 2701:
Schofield PN (1987). "Patterns, puzzles and paradigms - The riddle of the homeobox".
2642: 2638: 2607: 2603: 2569: 2515: 2488: 999: 928: 208: 176: 134: 10827: 4924: 4919: 4812:
Lodish H, Berk A, Matsudaira P, Kaiser CA, Krieger M, Scott MP, et al. (2003).
4794: 4510: 3705: 3661: 3553: 3458: 3247: 3036: 2989: 2722: 73: 10853: 10822: 10817: 10772: 10400: 7715: 7697: 6266: 6213: 5987: 4871: 4774: 4739: 4694: 4684: 4648: 4628: 4591: 4583: 4544: 4490: 4463: 4443: 4406: 4365: 4357: 4316: 4308: 4266: 4229: 4188: 4180: 4139: 4098: 4090: 4049: 4008: 4000: 3959: 3951: 3910: 3902: 3861: 3834: 3814: 3779: 3756: 3736: 3685: 3639: 3590: 3580: 3533: 3496: 3488: 3438: 3401: 3391: 3342: 3324: 3227: 3190: 3182: 3141: 3133: 3016: 2969: 2931: 2921: 2886: 2866: 2792: 2784: 2745: 2710: 2634: 2599: 2559: 2551: 2507: 1261: 1160: 1127:
Hox genes are the most commonly known subset of homeobox genes. They are essential
873: 864: 814: 798: 164: 3805:
Zákány J, Duboule D (April 1999). "Hox genes in digit development and evolution".
3477:"A comprehensive classification and evolutionary analysis of plant homeobox genes" 86: 10863: 10767: 10577: 9856: 9079: 8949: 8113: 4944: 4910: 4361: 4344:
Zhu Y, Cuevas IC, Gabriel RA, Su H, Nishimura S, Gao P, et al. (June 2009).
3955: 3396: 1600: 1149:
cause displacement of body segments during embryonic development. This is called
1003: 720: 98: 10923: 10392: 9953: 8233: 8216: 6359: 6014: 5011: 4875: 4128:"Retroviral delivery of homeobox D3 gene induces cerebral angiogenesis in mice" 3906: 3309:
Proceedings of the National Academy of Sciences of the United States of America
3186: 2906:
Proceedings of the National Academy of Sciences of the United States of America
2329: 1227: 1175: 998:
by initiating the cascades of coregulated genes required to produce individual
4393:
Chen H, Rubin E, Zhang H, Chung S, Jie CC, Garrett E, et al. (May 2005).
3231: 2555: 10917: 10831: 10745: 10613: 10447: 10424: 8811: 8151: 6576: 6364: 5692: 4898: 4587: 3866: 3849: 3604: 3329: 3137: 1444: 1388: 1271: 1146: 991: 962: 830: 674: 3783: 3585: 3568: 3492: 2926: 10656: 10477: 10467: 10361: 9673: 9556: 9548: 8919: 8875: 7878: 7726: 4883: 4786: 4751: 4708: 4689: 4640: 4548: 4455: 4420: 4411: 4394: 4379: 4330: 4278: 4270: 4243: 4202: 4153: 4112: 4063: 4054: 4037: 3973: 3924: 3875: 3826: 3653: 3545: 3510: 3450: 3415: 3239: 3204: 2573: 2511: 1496: 1275: 1179: 1155: 1011: 916: 905: 846: 777: 724: 705: 673:
that are involved in the regulation of patterns of anatomical development (
36: 4605: 4556: 4502: 4094: 4022: 4004: 3818: 3791: 3748: 3697: 3356: 3155: 3028: 2981: 2945: 2878: 2806: 2773:"Genomic and cDNA clones of the homeotic locus Antennapedia in Drosophila" 2757: 2646: 2611: 2519: 1256:
Proteins containing a POU region consist of a homeodomain and a separate,
138: 10592: 10572: 10045: 9648: 8128: 7843: 7808: 6197: 6002: 5997: 5440: 5244: 5239: 5135: 5015: 4778: 4312: 3987:
Boudreau N, Andrews C, Srebrow A, Ravanpay A, Cheresh DA (October 1997).
3122:"Differential DNA binding properties of three human homeodomain proteins" 2278: 1937: 1918: 1612: 1333: 1183: 969: 877: 810: 754: 10836: 10536: 10489: 10357: 10308: 9780: 9384: 9293: 9273: 9246: 8593: 8342: 8191: 8179: 8174: 7173: 7168: 5932: 5927: 5905: 5771: 5589: 5293: 5234: 5229: 5209: 3620:"Hox proteins: sculpting body parts by activating localized cell death" 3268:
RNA and the Regulation of Gene Expression: A Hidden Layer of Complexity
2262: 2254: 2250: 2164: 2100: 2056: 1307: 1251: 1201: 1188: 1031: 920: 901: 897: 889: 881: 850: 771: 743: 122: 30: 4234: 4217: 4167:
Myers C, Charboneau A, Cheung I, Hanks D, Boudreau N (December 2002).
3595: 2492: 640: 634: 628: 622: 616: 610: 604: 598: 592: 586: 580: 574: 568: 562: 556: 550: 544: 538: 532: 526: 520: 514: 508: 502: 496: 490: 484: 478: 472: 466: 460: 454: 448: 442: 436: 430: 424: 418: 412: 406: 400: 394: 388: 382: 376: 370: 364: 358: 352: 346: 340: 334: 328: 322: 316: 310: 304: 298: 292: 286: 280: 274: 268: 262: 256: 250: 244: 238: 232: 226: 220: 214: 10787: 10755: 10522: 10428: 10231: 10221: 10204: 9678: 9451: 8697: 6402: 5831: 5489: 4978: 4744:
10.1002/1097-010X(20001215)288:4<345::AID-JEZ7>3.0.CO;2-Y
3740: 3338: 3266: 3262: 2870: 2469: 2430: 1216: 1109: 1088: 1084: 1067: 1059: 1047: 912: 853:
long domain composed of three alpha helixes. The following shows the
834: 690: 663: 4447: 3850:"The role of homeobox genes in vascular remodeling and angiogenesis" 3769: 3537: 3442: 2821:"Walter Jakob Gehring (1939-2014) | The Embryo Project Encyclopedia" 1713:
In addition, humans have the following homeobox genes and proteins:
1295:
The Hox genes in humans are organized in four chromosomal clusters:
10750: 9698: 6397: 6354: 5406: 4940: 4295:
Arderiu G, Cuevas I, Chen A, Carrio M, East L, Boudreau NJ (2007).
1235: 1122: 1080: 1026: 1022: 954: 739: 728: 716: 93: 9476: 3674: 3003:
McGinnis W, Garber RL, Wirz J, Kuroiwa A, Gehring WJ (June 1984).
2958: 1142:
space during development. This phenomenon is called colinearity.
10482: 10098: 10078: 10073: 9785: 7759: 7543: 5455: 5450: 5445: 5433: 5428: 1906: 1541: 1133: 1128: 932: 732: 697: 117: 10462: 10279: 10274: 10269: 10259: 10254: 9973: 9528: 9523: 9518: 9513: 8779: 8774: 8651: 8646: 8641: 8626: 8617: 8612: 8607: 8586: 8500: 8495: 8283: 8278: 8258: 8253: 8243: 8238: 8076: 8028: 8023: 8018: 8013: 7983: 7978: 7973: 7968: 7938: 7888: 7883: 7646: 7566: 7538: 7533: 7528: 7523: 7518: 7513: 7508: 7503: 7498: 7493: 7488: 7483: 7478: 7473: 7468: 7463: 7458: 7453: 7443: 7438: 7433: 7428: 7423: 7418: 7413: 7403: 7398: 7393: 7353: 7306: 7301: 7296: 7291: 7286: 7281: 7271: 7259: 7254: 7020: 7015: 7010: 6892: 6887: 6859: 6854: 6839: 6834: 6829: 6819: 6814: 6802: 6797: 6169: 6164: 6159: 6154: 6149: 6124: 6051: 6019: 5962: 5957: 5744: 5739: 5734: 5618: 5423: 5313: 5308: 5281: 5276: 5271: 5197: 4903: 4216:
Mace KA, Hansen SL, Myers C, Young DM, Boudreau N (June 2005).
4079:"Homeobox B3 promotes capillary morphogenesis and angiogenesis" 2381: 2377: 2357: 2353: 2349: 2345: 2337: 2218: 2176: 2172: 2136: 2132: 1865: 1816: 1812: 1808: 1804: 1800: 1796: 1792: 1788: 1784: 1776: 1772: 1691: 1687: 1533: 1529: 1525: 1521: 1481: 1477: 1473: 1469: 1429: 1373: 1369: 1365: 958: 948:
Homeodomains can bind both specifically and nonspecifically to
936: 682: 678: 196: 3986: 3303:
Bharathan G, Janssen BJ, Kellogg EA, Sinha N (December 1997).
10323: 10301: 10296: 10264: 10153: 10148: 10093: 10088: 10083: 10027: 9936: 9931: 9926: 9921: 9916: 9911: 9906: 9901: 9849: 9844: 9832: 9827: 9822: 9817: 9805: 9800: 9795: 9790: 9759: 9726: 9721: 9716: 9663: 9658: 9653: 9628: 9586: 9581: 9576: 9571: 9566: 9561: 9533: 9486: 9481: 9427: 9422: 9417: 9412: 9389: 9164: 9149: 9144: 9139: 9134: 9129: 9124: 9119: 9114: 9109: 9099: 9089: 9084: 9069: 9064: 9054: 9049: 9044: 9034: 9029: 9024: 9019: 9014: 9009: 9004: 8974: 8969: 8959: 8954: 8939: 8934: 8929: 8924: 8858: 8853: 8848: 8821: 8796: 8764: 8757: 8752: 8658: 8636: 8631: 8603: 8581: 8576: 8571: 8566: 8461: 8456: 8401: 8394: 8389: 8374: 8347: 8008: 8003: 7998: 7993: 7988: 7963: 7958: 7953: 7948: 7943: 7933: 7928: 7923: 7918: 7913: 7908: 7903: 7898: 7893: 7873: 7868: 7863: 7858: 7853: 7848: 7833: 7828: 7653: 7641: 7636: 7631: 7626: 7594: 7589: 7388: 7378: 7373: 7368: 7363: 7358: 7348: 7343: 7338: 7333: 7249: 7239: 7232: 7227: 7222: 7217: 7207: 7151: 7146: 7141: 7136: 7131: 7126: 7121: 7042: 7037: 7032: 6976: 6971: 6870: 6849: 6844: 6718: 6713: 6708: 6703: 6698: 6693: 5900: 5665: 5660: 5655: 5645: 5640: 5635: 5625: 5613: 5563: 5543: 5484: 5472: 5467: 5391: 5384: 5379: 5369: 5362: 5357: 5288: 5219: 5192: 5187: 5170: 5165: 5160: 5155: 5150: 5140: 5128: 5123: 5101: 5091: 5086: 5076: 4721: 4673:"Classification and nomenclature of all human homeobox genes" 4256: 3119: 2310: 2302: 2192: 2160: 2156: 2152: 2148: 2144: 2140: 2084: 2080: 2064: 1969: 1965: 1953: 1945: 1930: 1926: 1842: 1762: 1758: 1699: 1695: 1659: 1655: 1589: 1585: 1517: 1513: 1509: 1505: 1501: 1465: 1461: 1457: 1453: 1449: 1425: 1421: 1417: 1413: 1409: 1405: 1401: 1397: 1393: 1361: 1357: 1353: 1349: 1345: 1341: 1337: 949: 793:
homeobox sequence was independently reported by Ernst Hafen,
686: 4618: 4169:"Sustained expression of homeobox D10 inhibits angiogenesis" 3944:
The International Journal of Biochemistry & Cell Biology
3302: 731:, which is observed when some of these genes are mutated in 10760: 10350: 10345: 10340: 10330: 10318: 10313: 10160: 10143: 10007: 10002: 9997: 9968: 9963: 9896: 9891: 9886: 9881: 9876: 9871: 9866: 9861: 9812: 9706: 9668: 9643: 9638: 9633: 9616: 9508: 9501: 9496: 9377: 9372: 9367: 9362: 9357: 9352: 9347: 9342: 9332: 9325: 9315: 9310: 9298: 9288: 9283: 9266: 9261: 9256: 9239: 9234: 9229: 9204: 9199: 9194: 8912: 8907: 8902: 8897: 8892: 8831: 8806: 8801: 8742: 8737: 8732: 8727: 8722: 8717: 8712: 8707: 8702: 8673: 8668: 8561: 8556: 8551: 8546: 8532: 8527: 8522: 8517: 8512: 8483: 8478: 8473: 8439: 8434: 8429: 8424: 8419: 8414: 8379: 8367: 8362: 8357: 8310: 8305: 8300: 8295: 8290: 8211: 8196: 8186: 8162: 8157: 8143: 8138: 8133: 8123: 8118: 8106: 8101: 8045: 8040: 7818: 7803: 7798: 7786: 7781: 7614: 7609: 7604: 7448: 7383: 7328: 7323: 7318: 7202: 7197: 7192: 7116: 7111: 7106: 7101: 7096: 7091: 7086: 7081: 7076: 7059: 7054: 6998: 6993: 6961: 6956: 6951: 6941: 6936: 6929: 6924: 6919: 6914: 6904: 6899: 6882: 6740: 6735: 6730: 6658: 6119: 6114: 6109: 6104: 6099: 6094: 6007: 5992: 5969: 5942: 5915: 5910: 5875: 5853: 5848: 5843: 5826: 5821: 5811: 5801: 5751: 5709: 5704: 5687: 5682: 5677: 5575: 5570: 5558: 5516: 5511: 5501: 5416: 5411: 5401: 5320: 5303: 5266: 5254: 5249: 5224: 5182: 5111: 5106: 5081: 5064: 5059: 5054: 5049: 5044: 5034: 4936: 2314: 2298: 2294: 2290: 2274: 2266: 2258: 2246: 2242: 2238: 2234: 2208: 2204: 2128: 2124: 2120: 2116: 2112: 2108: 2104: 2096: 2092: 2068: 2052: 2040: 1996: 1992: 1988: 1977: 1961: 1957: 1896: 1892: 1888: 1884: 1880: 1873: 1869: 1746: 1738: 1734: 1730: 1726: 1718: 1679: 1675: 1671: 1651: 1647: 1643: 1639: 1635: 1631: 1624: 1620: 1616: 1608: 1604: 1593: 1581: 1569: 1565: 1549: 1545: 1239: 670: 158: 80: 68: 4811: 4166: 3474: 2848: 735:. The homeobox domain was first identified in a number of 9992: 9621: 9611: 9491: 8887: 8444: 7793: 7244: 6981: 6475: 5947: 5776: 5766: 5761: 5553: 5548: 3002: 2590:
Gehring WJ (August 1992). "The homeobox in perspective".
2072: 1667: 893: 709: 46: 4297:"HoxA5 stabilizes adherens junctions via increased Akt1" 2497: 1544:
genes are analogously found in four areas. They include
769:
The existence of homeobox genes was first discovered in
6193: 4294: 4076: 3718: 3475:
Mukherjee K, Brocchieri L, Bürglin TR (December 2009).
2738:
Biochimica et Biophysica Acta (BBA) - Reviews on Cancer
1058:
Mutations to homeobox genes can produce easily visible
4935:
This article incorporates text from the public domain
4125: 3526:
Wiley Interdisciplinary Reviews: Developmental Biology
2625:
Gehring WJ (December 1993). "Exploring the homeobox".
4820:(5th ed.). New York: W.H. Freeman and Company. 4395:"Identification of transcriptional targets of HOXA5" 4350:
Journal of Neuropathology and Experimental Neurology
4290: 4288: 4215: 3217: 2770: 10122: 4670: 4392: 3937: 2735: 2667:. U.S. National Library of Medicine. Archived from 4813: 4343: 4077:Myers C, Charboneau A, Boudreau N (January 2000). 3938:Dunn J, Simmons R, Thabet S, Jo H (October 2015). 3895:Arteriosclerosis, Thrombosis, and Vascular Biology 3524:Holland PW (2013). "Evolution of homeobox genes". 3369: 3175:Arteriosclerosis, Thrombosis, and Vascular Biology 4671:Holland PW, Booth HA, Bruford EA (October 2007). 4285: 3989:"Induction of the angiogenic phenotype by Hox D3" 781:that caused this homeotic phenotype. Analysis of 10915: 10422: 7693: 4843:(2nd ed.). New York: Garland Pub. pp.  3428: 3054: 4433: 3470: 3468: 2537: 1238:development, and formation of face structures. 919:proteins that alter the expression of genes in 4861: 4035: 3260: 2533: 2531: 2529: 10408: 10383:transcription factor/coregulator deficiencies 9454:β-Scaffold factors with minor groove contacts 4964: 4666: 4664: 4662: 4660: 4658: 4132:Journal of Cerebral Blood Flow and Metabolism 3804: 3611: 2696: 2694: 2585: 2583: 4834: 4767:American Journal of Medical Genetics. Part A 4612: 4534: 4476: 3888: 3668: 3465: 3363: 3211: 3168: 3113: 2700: 4764: 4563: 3882: 3847: 2899: 2526: 1046:can silence the Hox genes by modulation of 10415: 10401: 4971: 4957: 4655: 3162: 2729: 2691: 2618: 2580: 2481: 2433:. Grouped as Pax2/5/8, Pax3/7, and Pax4/6. 1568:. Other genes considered Hox-like include 1099: 880:are connected by a short loop region. The 825:in 1984. Isolation of homologous genes by 29: 4927:at the U.S. National Library of Medicine 4698: 4688: 4595: 4410: 4369: 4320: 4233: 4192: 4143: 4102: 4053: 4012: 3963: 3914: 3865: 3643: 3594: 3584: 3500: 3405: 3395: 3346: 3328: 3194: 3145: 2935: 2925: 2796: 2771:Garber RL, Kuroiwa A, Gehring WJ (1983). 2563: 16:DNA pattern affecting anatomy development 4036:Boudreau NJ, Varner JA (February 2004). 1108: 1014:and preventing cell differentiation. 1006:. Other proteins in the family, such as 863: 840: 753: 4569: 3566: 3523: 3254: 2624: 2589: 1290: 1281: 943: 10916: 10905:Index of evolutionary biology articles 3617: 3060: 2402:Grouped as Lmx 1/5, 2/9, 3/4, and 6/8. 980: 10396: 10121: 9450: 7692: 6192: 4995: 4994: 4952: 4436:Nature Reviews Molecular Cell Biology 935:in the turn which is needed to avoid 872:Helix 2 and helix 3 form a so-called 3889:Dunn J, Thabet S, Jo H (July 2015). 3848:Gorski DH, Walsh K (November 2000). 3169:Dunn J, Thabet S, Jo H (July 2015). 2538:Bürglin TR, Affolter M (June 2016). 857:homeodomain (~60 amino acid chain): 6137:(1.6) Basic helix-span-helix (bHSH) 4399:The Journal of Biological Chemistry 4042:The Journal of Biological Chemistry 994:. Many homeodomain proteins induce 884:two helices of the homeodomain are 13: 10949:Evolutionary developmental biology 10715:Evolutionary developmental biology 4804: 4145:10.1097/01.WCB.0000141770.09022.AB 3573:Frontiers in Ecology and Evolution 2789:10.1002/j.1460-2075.1983.tb01696.x 2465:Evolutionary developmental biology 911:Homeodomain proteins are found in 14: 10960: 4892: 4839:Introduction to protein structure 4173:The American Journal of Pathology 2900:Scott MP, Weiner AJ (July 1984). 2540:"Homeodomain proteins: an update" 2411:Grouped as Six 1/2, 3/6, and 4/5. 985:Homeodomain proteins function as 10672:Evolution of sexual reproduction 4916:Eukaryotic Linear Motif resource 4633:10.1111/j.1525-142X.2007.00153.x 10124:(0) Other transcription factors 9408:transcriptional enhancer factor 5025:Activating transcription factor 4758: 4724:Journal of Experimental Zoology 4715: 4528: 4517:from the original on 2021-05-02 4477:Gruss P, Walther C (May 1992). 4470: 4427: 4386: 4337: 4250: 4209: 4160: 4119: 4070: 4029: 3980: 3931: 3841: 3798: 3763: 3712: 3560: 3517: 3481:Molecular Biology and Evolution 3422: 3296: 3285:from the original on 2012-01-02 3083: 3072:from the original on 2011-07-21 3043:from the original on 2021-05-04 2996: 2952: 2893: 2842: 2831:from the original on 2019-12-09 2813: 2445: 2436: 2423: 2414: 2405: 2396: 1230:development, generation of the 1083:since before the earliest true 876:(HTH) structure, where the two 845:The characteristic homeodomain 10443:Genotype–phenotype distinction 4259:Lymphatic Research and Biology 2764: 2682: 2653: 2592:Trends in Biochemical Sciences 1: 10700:Regulation of gene expression 9338:Interferon regulatory factors 7577:(2.5) Alternating composition 6773:General transcription factors 4301:Cell Adhesion & Migration 4185:10.1016/S0002-9440(10)64488-4 3645:10.1016/S0960-9822(02)01291-5 3261:Portoso M, Cavalli G (2008). 3220:Journal of Molecular Medicine 3091:"CATH Superfamily 1.10.10.60" 2475: 1601:"distal-less homeobox" family 1260:POU domain that contains two 1017: 153:Available protein structures: 10870:Endless Forms Most Beautiful 10650:Evolution of genetic systems 10458:Gene–environment correlation 10453:Gene–environment interaction 8623:Octamer transcription factor 5331:(1.2) Basic helix-loop-helix 4570:Bürglin TR (November 1997). 4495:10.1016/0092-8674(92)90281-G 4362:10.1097/NEN.0b013e3181a491ce 3956:10.1016/j.biocel.2015.05.001 3690:10.1016/0092-8674(84)90371-4 3397:10.1371/journal.pone.0000153 3021:10.1016/0092-8674(84)90370-2 2974:10.1016/0092-8674(84)90371-4 2750:10.1016/0304-419x(89)90033-4 2715:10.1016/0166-2236(87)90113-5 2639:10.1016/0378-1119(93)90068-E 2604:10.1016/0968-0004(92)90434-B 2500:Journal of Molecular Biology 1245: 1210: 1195: 1104: 1073: 1053: 1010:are involved in maintaining 977:of a specific target gene. 749: 669:Homeoboxes are found within 7: 10849:Christiane Nüsslein-Volhard 5397:Myogenic regulatory factors 4835:Tooze C, Branden J (1999). 4621:Evolution & Development 4083:The Journal of Cell Biology 3993:The Journal of Cell Biology 3618:Alonso CR (November 2002). 2458: 1320:HOXA (or sometimes HOX1) - 992:early embryonic development 689:, and numerous single cell 10: 10965: 10725:Hedgehog signaling pathway 10602:Developmental architecture 4934: 4876:10.1016/j.gene.2006.08.011 3907:10.1161/ATVBAHA.115.305042 3271:. Caister Academic Press. 3187:10.1161/ATVBAHA.115.305042 1249: 1214: 1199: 1120: 10902: 10881: 10810: 10738: 10692: 10685: 10649: 10601: 10565: 10552:Transgressive segregation 10498: 10435: 10378: 10240: 10200: 10169: 10134: 10130: 10117: 10059: 10036: 10018: 9768: 9742: 9694: 9597: 9544: 9464: 9460: 9446: 9398: 9217:(3.5) Tryptophan clusters 9215: 9175: 8871: 8688: 8328: 8054: 7742: 7723: 7711: 7707: 7688: 7662: 7575: 7554: 6756: 6676: 6647: 6627: 6602: 6565: 6484: 6380: 6228: 6209: 6205: 6188: 6135: 6080: 5978: 5888: 5864: 5787: 5720: 5584: 5534: 5343: 5329: 5007: 5003: 4990: 3232:10.1007/s00109-014-1181-y 2556:10.1007/s00412-015-0543-8 1170:In vertebrates, the four 1087:, making these genes pre- 704:sharing a characteristic 207: 195: 175: 157: 152: 148: 128: 116: 104: 92: 79: 67: 59: 54: 39:homeodomain protein from 28: 23: 10038:(4.10) Cold-shock domain 4929:Medical Subject Headings 3867:10.1161/01.res.87.10.865 3807:Cell and Tissue Research 3330:10.1073/pnas.94.25.13749 3068:. Karolinksa Institute. 1070:of segmented animals. 996:cellular differentiation 693:. Homeobox genes encode 10730:Notch signaling pathway 10705:Gene regulatory network 10588:Dual inheritance theory 4984:intracellular receptors 4222:Journal of Cell Science 3784:10.1242/dev.122.10.2997 3586:10.3389/fevo.2016.00036 3431:Nature Reviews Genetics 2927:10.1073/pnas.81.13.4115 2665:Genetics Home Reference 1258:structurally homologous 1115:Drosophila melanogaster 1113:Hox gene expression in 1100:Types of homeobox genes 1044:Polycomb-group proteins 45:bound to a fragment of 42:Drosophila melanogaster 10929:Developmental genetics 10778:cis-regulatory element 10686:Control of development 10566:Non-genetic influences 10532:evolutionary landscape 4816:Molecular Cell Biology 4690:10.1186/1741-7007-5-47 4588:10.1093/nar/25.21.4173 4576:Nucleic Acids Research 4549:10.1242/dev.113.4.1435 4412:10.1074/jbc.M413528200 4271:10.1089/lrb.2005.3.240 4055:10.1074/jbc.M305190200 3138:10.1093/nar/20.17.4465 3126:Nucleic Acids Research 2512:10.1006/jmbi.1993.1661 1118: 869: 766: 10939:Transcription factors 10889:Nature versus nurture 10793:Cell surface receptor 10710:Evo-devo gene toolkit 10609:Developmental biology 10547:Polygenic inheritance 10473:Quantitative genetics 9747:TATA-binding proteins 4980:Transcription factors 4095:10.1083/jcb.148.2.343 4005:10.1083/jcb.139.1.257 3819:10.1007/s004410051262 3493:10.1093/molbev/msp201 1112: 1025:and their associated 987:transcription factors 965:to the DNA backbone. 961:residues, which form 867: 841:Homeodomain structure 789:genes containing the 757: 708:structure that binds 702:transcription factors 10798:Transcription factor 10513:Genetic assimilation 10500:Genetic architecture 4779:10.1002/ajmg.a.31252 4479:"Pax in development" 4313:10.4161/cam.1.4.5448 3854:Circulation Research 1291:Human homeobox genes 1282:Plant homeobox genes 1093:neofunctionalization 1034:is known to use the 944:Sequence specificity 803:Walter Jakob Gehring 729:mutational phenotype 719:is a term coined by 10894:Morphogenetic field 10811:Influential figures 10242:(0.6) Miscellaneous 9773:High-mobility group 9469:Rel homology region 6459:Testicular receptor 6200:DNA-binding domains 4736:2000JEZ...288..345C 3733:1987Natur.325..816S 3636:2002CBio...12.R776A 3567:Ferrier DE (2016). 3388:2007PLoSO...2..153R 3321:1997PNAS...9413749B 3063:"The homeobox page" 2918:1984PNAS...81.4115S 2863:1984Natur.308..428M 1145:Mutations in these 981:Biological function 807:University of Basel 10583:Genomic imprinting 9607:p53 p63 p73 family 9180:Heat shock factors 4909:2021-06-01 at the 4228:(Pt 12): 2567–77. 2420:Questionable, per 1267:consensus sequence 1232:frontal eye fields 1139:Edward De Robertis 1119: 929:repressor proteins 870: 827:Edward de Robertis 819:Indiana University 817:and Amy Weiner of 767: 700:products that are 10911: 10910: 10844:Eric F. Wieschaus 10806: 10805: 10624:Pattern formation 10528:Fitness landscape 10390: 10389: 10374: 10373: 10370: 10369: 10113: 10112: 10109: 10108: 9442: 9441: 9438: 9437: 8684: 8683: 8324: 8323: 7684: 7683: 7680: 7679: 6672: 6671: 6528:Mineralocorticoid 6184: 6183: 6180: 6179: 5884: 5883: 4997:(1) Basic domains 4854:978-0-8153-2305-1 4827:978-0-7167-4366-8 4235:10.1242/jcs.02399 3778:(10): 2997–3011. 3278:978-1-904455-25-7 1539: 1538: 849:consists of a 60- 652: 651: 648: 647: 202:structure summary 10956: 10854:William McGinnis 10823:Richard Lewontin 10818:C. H. Waddington 10690: 10689: 10667:Neutral networks 10417: 10410: 10403: 10394: 10393: 10214:-related factors 10132: 10131: 10119: 10118: 10020:(4.9) Grainyhead 9462: 9461: 9448: 9447: 9400:(3.6) TEA domain 8690:(3.2) Paired box 8331: 8065: 8059: 7753: 7747: 7740: 7739: 7736: 7730: 7721: 7720: 7709: 7708: 7698:Helix-turn-helix 7690: 7689: 6652: 6632: 6607: 6570: 6540:Estrogen related 6489: 6385: 6233: 6226: 6225: 6214:Nuclear receptor 6207: 6206: 6190: 6189: 5869: 5790: 5723: 5592: 5537: 5346: 5341: 5340: 5005: 5004: 4992: 4991: 4973: 4966: 4959: 4950: 4949: 4887: 4858: 4842: 4831: 4819: 4799: 4798: 4762: 4756: 4755: 4719: 4713: 4712: 4702: 4692: 4668: 4653: 4652: 4616: 4610: 4609: 4599: 4567: 4561: 4560: 4532: 4526: 4525: 4523: 4522: 4474: 4468: 4467: 4431: 4425: 4424: 4414: 4405:(19): 19373–80. 4390: 4384: 4383: 4373: 4341: 4335: 4334: 4324: 4292: 4283: 4282: 4254: 4248: 4247: 4237: 4213: 4207: 4206: 4196: 4164: 4158: 4157: 4147: 4123: 4117: 4116: 4106: 4074: 4068: 4067: 4057: 4033: 4027: 4026: 4016: 3984: 3978: 3977: 3967: 3935: 3929: 3928: 3918: 3886: 3880: 3879: 3869: 3845: 3839: 3838: 3802: 3796: 3795: 3767: 3761: 3760: 3741:10.1038/325816a0 3716: 3710: 3709: 3672: 3666: 3665: 3647: 3615: 3609: 3608: 3598: 3588: 3564: 3558: 3557: 3521: 3515: 3514: 3504: 3472: 3463: 3462: 3426: 3420: 3419: 3409: 3399: 3367: 3361: 3360: 3350: 3332: 3315:(25): 13749–53. 3300: 3294: 3293: 3291: 3290: 3258: 3252: 3251: 3215: 3209: 3208: 3198: 3166: 3160: 3159: 3149: 3117: 3111: 3110: 3108: 3106: 3101:on 9 August 2017 3097:. Archived from 3087: 3081: 3080: 3078: 3077: 3067: 3058: 3052: 3051: 3049: 3048: 3000: 2994: 2993: 2956: 2950: 2949: 2939: 2929: 2897: 2891: 2890: 2871:10.1038/308428a0 2857:(5958): 428–33. 2846: 2840: 2839: 2837: 2836: 2817: 2811: 2810: 2800: 2777:The EMBO Journal 2768: 2762: 2761: 2733: 2727: 2726: 2698: 2689: 2686: 2680: 2679: 2677: 2676: 2657: 2651: 2650: 2622: 2616: 2615: 2587: 2578: 2577: 2567: 2535: 2524: 2523: 2495: 2485: 2452: 2449: 2443: 2440: 2434: 2427: 2421: 2418: 2412: 2409: 2403: 2400: 1298: 1297: 1262:helix-turn-helix 900:and the exposed 874:helix-turn-helix 815:Matthew P. Scott 799:William McGinnis 643: 637: 631: 625: 619: 613: 607: 601: 595: 589: 583: 577: 571: 565: 559: 553: 547: 541: 535: 529: 523: 517: 511: 505: 499: 493: 487: 481: 475: 469: 463: 457: 451: 445: 439: 433: 427: 421: 415: 409: 403: 397: 391: 385: 379: 373: 367: 361: 355: 349: 343: 337: 331: 325: 319: 313: 307: 301: 295: 289: 283: 277: 271: 265: 259: 253: 247: 241: 235: 229: 223: 217: 150: 149: 33: 21: 20: 10964: 10963: 10959: 10958: 10957: 10955: 10954: 10953: 10934:Protein domains 10914: 10913: 10912: 10907: 10898: 10877: 10864:Sean B. Carroll 10802: 10734: 10681: 10645: 10597: 10578:Maternal effect 10561: 10494: 10431: 10421: 10391: 10386: 10366: 10236: 10196: 10165: 10126: 10105: 10055: 10032: 10014: 9764: 9738: 9690: 9593: 9540: 9456: 9434: 9394: 9211: 9171: 8867: 8680: 8329: 8320: 8061: 8060: 8055: 8050: 7749: 7748: 7743: 7732: 7731: 7724: 7703: 7676: 7658: 7571: 7559: 7550: 6765: 6761: 6752: 6681: 6678:(2.2) Other Cys 6668: 6648: 6643: 6628: 6623: 6603: 6598: 6566: 6561: 6496:Steroid hormone 6485: 6480: 6381: 6376: 6240:Thyroid hormone 6229: 6220: 6201: 6176: 6131: 6076: 5974: 5880: 5867: 5865: 5860: 5788: 5783: 5721: 5716: 5587: 5585: 5580: 5535: 5530: 5344: 5325: 4999: 4986: 4977: 4947: 4911:Wayback Machine 4895: 4890: 4855: 4828: 4807: 4805:Further reading 4802: 4773:(13): 1366–74. 4763: 4759: 4720: 4716: 4669: 4656: 4617: 4613: 4582:(21): 4173–80. 4568: 4564: 4533: 4529: 4520: 4518: 4475: 4471: 4448:10.1038/nrm1499 4432: 4428: 4391: 4387: 4342: 4338: 4293: 4286: 4255: 4251: 4214: 4210: 4179:(6): 2099–109. 4165: 4161: 4124: 4120: 4075: 4071: 4034: 4030: 3985: 3981: 3936: 3932: 3887: 3883: 3846: 3842: 3803: 3799: 3768: 3764: 3727:(6107): 816–8. 3717: 3713: 3673: 3669: 3624:Current Biology 3616: 3612: 3565: 3561: 3538:10.1002/wdev.78 3522: 3518: 3487:(12): 2775–94. 3473: 3466: 3443:10.1038/nrg1723 3427: 3423: 3368: 3364: 3301: 3297: 3288: 3286: 3279: 3259: 3255: 3216: 3212: 3167: 3163: 3132:(17): 4465–72. 3118: 3114: 3104: 3102: 3095:www.cathdb.info 3089: 3088: 3084: 3075: 3073: 3065: 3059: 3055: 3046: 3044: 3001: 2997: 2957: 2953: 2898: 2894: 2847: 2843: 2834: 2832: 2819: 2818: 2814: 2783:(11): 2027–36. 2769: 2765: 2734: 2730: 2703:Trends Neurosci 2699: 2692: 2687: 2683: 2674: 2672: 2659: 2658: 2654: 2633:(1–2): 215–21. 2623: 2619: 2588: 2581: 2536: 2527: 2487: 2486: 2482: 2478: 2461: 2456: 2455: 2450: 2446: 2441: 2437: 2428: 2424: 2419: 2415: 2410: 2406: 2401: 2397: 1293: 1284: 1274:, particularly 1254: 1248: 1219: 1213: 1204: 1198: 1125: 1107: 1102: 1076: 1056: 1020: 983: 975:promoter region 946: 888:and the longer 862: 843: 752: 721:William Bateson 639: 633: 627: 621: 615: 609: 603: 597: 591: 585: 579: 573: 567: 561: 555: 549: 543: 537: 531: 525: 519: 513: 507: 501: 495: 489: 483: 477: 471: 465: 459: 453: 447: 441: 435: 429: 423: 417: 411: 405: 399: 393: 387: 381: 375: 369: 363: 357: 351: 345: 339: 333: 327: 321: 315: 309: 303: 297: 291: 285: 279: 273: 267: 261: 255: 249: 243: 237: 231: 225: 219: 213: 50: 17: 12: 11: 5: 10962: 10952: 10951: 10946: 10944:Homeobox genes 10941: 10936: 10931: 10926: 10909: 10908: 10903: 10900: 10899: 10897: 10896: 10891: 10885: 10883: 10879: 10878: 10876: 10875: 10874: 10873: 10861: 10856: 10851: 10846: 10841: 10840: 10839: 10828:François Jacob 10825: 10820: 10814: 10812: 10808: 10807: 10804: 10803: 10801: 10800: 10795: 10790: 10785: 10780: 10775: 10770: 10765: 10764: 10763: 10753: 10748: 10742: 10740: 10736: 10735: 10733: 10732: 10727: 10722: 10717: 10712: 10707: 10702: 10696: 10694: 10687: 10683: 10682: 10680: 10679: 10674: 10669: 10664: 10659: 10653: 10651: 10647: 10646: 10644: 10643: 10638: 10633: 10628: 10627: 10626: 10621: 10611: 10605: 10603: 10599: 10598: 10596: 10595: 10590: 10585: 10580: 10575: 10569: 10567: 10563: 10562: 10560: 10559: 10557:Sequence space 10554: 10549: 10544: 10539: 10534: 10525: 10520: 10515: 10510: 10504: 10502: 10496: 10495: 10493: 10492: 10487: 10486: 10485: 10475: 10470: 10465: 10460: 10455: 10450: 10445: 10439: 10437: 10433: 10432: 10420: 10419: 10412: 10405: 10397: 10388: 10387: 10379: 10376: 10375: 10372: 10371: 10368: 10367: 10365: 10364: 10355: 10354: 10353: 10348: 10343: 10333: 10328: 10327: 10326: 10321: 10316: 10306: 10305: 10304: 10299: 10289: 10284: 10283: 10282: 10277: 10272: 10267: 10262: 10257: 10246: 10244: 10238: 10237: 10235: 10234: 10229: 10224: 10218: 10216: 10198: 10197: 10195: 10194: 10189: 10184: 10178: 10176: 10167: 10166: 10164: 10163: 10158: 10157: 10156: 10151: 10140: 10138: 10128: 10127: 10115: 10114: 10111: 10110: 10107: 10106: 10104: 10103: 10102: 10101: 10096: 10091: 10086: 10081: 10076: 10065: 10063: 10057: 10056: 10054: 10053: 10048: 10042: 10040: 10034: 10033: 10031: 10030: 10024: 10022: 10016: 10015: 10013: 10012: 10011: 10010: 10005: 10000: 9995: 9985: 9984: 9983: 9978: 9977: 9976: 9971: 9966: 9951: 9946: 9941: 9940: 9939: 9934: 9929: 9924: 9919: 9914: 9909: 9904: 9899: 9894: 9889: 9884: 9879: 9874: 9869: 9864: 9854: 9853: 9852: 9847: 9837: 9836: 9835: 9830: 9825: 9820: 9810: 9809: 9808: 9803: 9798: 9793: 9783: 9777: 9775: 9766: 9765: 9763: 9762: 9757: 9751: 9749: 9740: 9739: 9737: 9736: 9731: 9730: 9729: 9724: 9719: 9714: 9703: 9701: 9692: 9691: 9689: 9688: 9683: 9682: 9681: 9676: 9671: 9666: 9661: 9656: 9651: 9646: 9641: 9636: 9626: 9625: 9624: 9619: 9614: 9603: 9601: 9599:(4.3) p53-like 9595: 9594: 9592: 9591: 9590: 9589: 9584: 9579: 9574: 9569: 9564: 9553: 9551: 9542: 9541: 9539: 9538: 9537: 9536: 9531: 9526: 9521: 9516: 9506: 9505: 9504: 9499: 9494: 9489: 9484: 9473: 9471: 9458: 9457: 9444: 9443: 9440: 9439: 9436: 9435: 9433: 9432: 9431: 9430: 9425: 9420: 9415: 9404: 9402: 9396: 9395: 9393: 9392: 9387: 9382: 9381: 9380: 9375: 9370: 9365: 9360: 9355: 9350: 9345: 9335: 9330: 9329: 9328: 9323: 9318: 9313: 9303: 9302: 9301: 9296: 9291: 9286: 9276: 9271: 9270: 9269: 9264: 9259: 9249: 9244: 9243: 9242: 9237: 9232: 9221: 9219: 9213: 9212: 9210: 9209: 9208: 9207: 9202: 9197: 9184: 9182: 9173: 9172: 9170: 9169: 9168: 9167: 9162: 9157: 9152: 9147: 9142: 9137: 9132: 9127: 9122: 9117: 9112: 9107: 9102: 9097: 9092: 9087: 9082: 9077: 9072: 9067: 9062: 9057: 9052: 9047: 9042: 9037: 9032: 9027: 9022: 9017: 9012: 9007: 9002: 8997: 8992: 8987: 8982: 8977: 8972: 8967: 8962: 8957: 8952: 8947: 8942: 8937: 8932: 8927: 8917: 8916: 8915: 8910: 8905: 8900: 8895: 8884: 8882: 8869: 8868: 8866: 8865: 8864: 8863: 8862: 8861: 8856: 8851: 8841: 8840: 8839: 8834: 8824: 8819: 8809: 8804: 8799: 8794: 8789: 8784: 8783: 8782: 8777: 8767: 8762: 8761: 8760: 8755: 8747: 8746: 8745: 8740: 8735: 8730: 8725: 8720: 8715: 8710: 8705: 8694: 8692: 8686: 8685: 8682: 8681: 8679: 8678: 8677: 8676: 8671: 8661: 8656: 8655: 8654: 8649: 8644: 8639: 8634: 8629: 8620: 8615: 8610: 8601: 8591: 8590: 8589: 8584: 8579: 8574: 8569: 8564: 8559: 8554: 8549: 8539: 8538: 8537: 8536: 8535: 8530: 8525: 8520: 8515: 8505: 8504: 8503: 8498: 8488: 8487: 8486: 8481: 8476: 8466: 8465: 8464: 8459: 8449: 8448: 8447: 8442: 8437: 8432: 8427: 8422: 8417: 8404: 8399: 8398: 8397: 8392: 8382: 8377: 8372: 8371: 8370: 8365: 8360: 8350: 8345: 8340: 8334: 8332: 8326: 8325: 8322: 8321: 8319: 8318: 8313: 8308: 8303: 8298: 8293: 8288: 8287: 8286: 8281: 8276: 8271: 8266: 8261: 8256: 8251: 8246: 8241: 8236: 8226: 8221: 8220: 8219: 8214: 8204: 8199: 8194: 8189: 8184: 8183: 8182: 8177: 8167: 8166: 8165: 8160: 8148: 8147: 8146: 8141: 8136: 8131: 8126: 8121: 8111: 8110: 8109: 8104: 8094: 8089: 8084: 8079: 8074: 8068: 8066: 8052: 8051: 8049: 8048: 8043: 8038: 8033: 8032: 8031: 8026: 8021: 8016: 8011: 8006: 8001: 7996: 7991: 7986: 7981: 7976: 7971: 7966: 7961: 7956: 7951: 7946: 7941: 7936: 7931: 7926: 7921: 7916: 7911: 7906: 7901: 7896: 7891: 7886: 7881: 7876: 7871: 7866: 7861: 7856: 7851: 7846: 7836: 7831: 7826: 7821: 7817:extended Hox: 7815: 7814: 7813: 7812: 7811: 7806: 7801: 7791: 7790: 7789: 7779: 7778: 7777: 7772: 7756: 7754: 7737: 7718: 7705: 7704: 7686: 7685: 7682: 7681: 7678: 7677: 7675: 7674: 7668: 7666: 7660: 7659: 7657: 7656: 7651: 7650: 7649: 7644: 7639: 7634: 7629: 7619: 7618: 7617: 7612: 7607: 7597: 7592: 7587: 7581: 7579: 7573: 7572: 7570: 7569: 7563: 7561: 7557: 7552: 7551: 7549: 7548: 7547: 7546: 7541: 7536: 7531: 7526: 7521: 7516: 7511: 7506: 7501: 7496: 7491: 7486: 7481: 7476: 7471: 7466: 7461: 7456: 7451: 7446: 7441: 7436: 7431: 7426: 7421: 7416: 7411: 7406: 7401: 7396: 7391: 7386: 7381: 7376: 7371: 7366: 7361: 7356: 7351: 7346: 7341: 7336: 7331: 7326: 7321: 7311: 7310: 7309: 7304: 7299: 7294: 7289: 7284: 7279: 7274: 7264: 7263: 7262: 7257: 7247: 7242: 7237: 7236: 7235: 7230: 7225: 7220: 7210: 7205: 7200: 7195: 7190: 7189: 7188: 7187: 7186: 7181: 7176: 7171: 7166: 7156: 7155: 7154: 7149: 7144: 7139: 7134: 7129: 7124: 7119: 7114: 7109: 7104: 7099: 7094: 7089: 7084: 7079: 7064: 7063: 7062: 7057: 7047: 7046: 7045: 7040: 7035: 7025: 7024: 7023: 7018: 7013: 7003: 7002: 7001: 6996: 6986: 6985: 6984: 6979: 6974: 6969: 6964: 6959: 6954: 6944: 6939: 6934: 6933: 6932: 6927: 6922: 6917: 6907: 6902: 6897: 6896: 6895: 6890: 6885: 6873: 6867: 6866: 6865: 6864: 6863: 6862: 6857: 6852: 6847: 6842: 6837: 6832: 6827: 6817: 6812: 6807: 6806: 6805: 6800: 6790: 6785: 6780: 6769: 6767: 6763: 6759: 6754: 6753: 6751: 6750: 6745: 6744: 6743: 6738: 6733: 6723: 6722: 6721: 6716: 6711: 6706: 6701: 6696: 6685: 6683: 6679: 6674: 6673: 6670: 6669: 6667: 6666: 6661: 6655: 6653: 6645: 6644: 6642: 6641: 6635: 6633: 6625: 6624: 6622: 6621: 6616: 6610: 6608: 6600: 6599: 6597: 6596: 6595: 6594: 6589: 6584: 6573: 6571: 6563: 6562: 6560: 6559: 6558: 6557: 6552: 6547: 6537: 6536: 6535: 6530: 6525: 6523:Glucocorticoid 6520: 6519: 6518: 6513: 6503: 6492: 6490: 6482: 6481: 6479: 6478: 6473: 6472: 6471: 6466: 6456: 6455: 6454: 6449: 6444: 6434: 6429: 6428: 6427: 6422: 6412: 6407: 6406: 6405: 6400: 6388: 6386: 6378: 6377: 6375: 6374: 6369: 6368: 6367: 6362: 6352: 6351: 6350: 6345: 6340: 6330: 6329: 6328: 6323: 6318: 6308: 6303: 6302: 6301: 6296: 6291: 6281: 6280: 6279: 6274: 6264: 6259: 6254: 6253: 6252: 6247: 6236: 6234: 6223: 6218: 6203: 6202: 6186: 6185: 6182: 6181: 6178: 6177: 6175: 6174: 6173: 6172: 6167: 6162: 6157: 6152: 6141: 6139: 6133: 6132: 6130: 6129: 6128: 6127: 6122: 6117: 6112: 6107: 6102: 6097: 6086: 6084: 6078: 6077: 6075: 6074: 6073: 6072: 6066: 6065: 6064: 6059: 6049: 6048: 6047: 6042: 6037: 6032: 6027: 6012: 6011: 6010: 6005: 6000: 5995: 5984: 5982: 5976: 5975: 5973: 5972: 5967: 5966: 5965: 5960: 5950: 5945: 5940: 5935: 5930: 5925: 5920: 5919: 5918: 5913: 5903: 5897: 5895: 5886: 5885: 5882: 5881: 5879: 5878: 5872: 5870: 5862: 5861: 5859: 5858: 5857: 5856: 5851: 5846: 5836: 5835: 5834: 5829: 5824: 5819: 5814: 5809: 5804: 5793: 5791: 5785: 5784: 5782: 5781: 5780: 5779: 5774: 5769: 5764: 5754: 5749: 5748: 5747: 5742: 5737: 5726: 5724: 5718: 5717: 5715: 5714: 5713: 5712: 5707: 5697: 5696: 5695: 5690: 5685: 5680: 5670: 5669: 5668: 5663: 5658: 5650: 5649: 5648: 5643: 5638: 5628: 5623: 5622: 5621: 5616: 5606: 5601: 5595: 5593: 5582: 5581: 5579: 5578: 5573: 5568: 5567: 5566: 5561: 5556: 5546: 5540: 5538: 5532: 5531: 5529: 5528: 5523: 5522: 5521: 5520: 5519: 5514: 5504: 5494: 5493: 5492: 5487: 5477: 5476: 5475: 5470: 5460: 5459: 5458: 5453: 5448: 5438: 5437: 5436: 5431: 5421: 5420: 5419: 5414: 5409: 5404: 5394: 5389: 5388: 5387: 5382: 5372: 5367: 5366: 5365: 5360: 5349: 5347: 5338: 5327: 5326: 5324: 5323: 5318: 5317: 5316: 5311: 5306: 5296: 5291: 5286: 5285: 5284: 5279: 5274: 5269: 5259: 5258: 5257: 5252: 5247: 5242: 5232: 5227: 5222: 5217: 5212: 5207: 5202: 5201: 5200: 5195: 5190: 5180: 5179: 5178: 5173: 5168: 5163: 5158: 5153: 5143: 5138: 5133: 5132: 5131: 5126: 5116: 5115: 5114: 5109: 5104: 5099: 5094: 5089: 5084: 5079: 5069: 5068: 5067: 5062: 5057: 5052: 5047: 5042: 5037: 5032: 5021: 5019: 5012:leucine zipper 5001: 5000: 4988: 4987: 4976: 4975: 4968: 4961: 4953: 4933: 4932: 4922: 4913: 4901: 4894: 4893:External links 4891: 4889: 4888: 4870:(1–2): 21–30. 4859: 4853: 4832: 4826: 4808: 4806: 4803: 4801: 4800: 4757: 4730:(4): 345–351. 4714: 4654: 4611: 4562: 4543:(4): 1435–49. 4527: 4469: 4442:(11): 920–31. 4426: 4385: 4336: 4284: 4249: 4208: 4159: 4138:(11): 1280–7. 4118: 4069: 4028: 3979: 3930: 3881: 3860:(10): 865–72. 3840: 3797: 3762: 3711: 3667: 3630:(22): R776-8. 3610: 3559: 3516: 3464: 3437:(12): 881–92. 3421: 3362: 3295: 3277: 3253: 3210: 3161: 3112: 3082: 3053: 2995: 2968:(2): 409–414. 2951: 2912:(13): 4115–9. 2892: 2841: 2825:embryo.asu.edu 2812: 2763: 2728: 2690: 2681: 2652: 2617: 2579: 2550:(3): 497–521. 2525: 2506:(4): 1084–93. 2479: 2477: 2474: 2473: 2472: 2467: 2460: 2457: 2454: 2453: 2444: 2435: 2422: 2413: 2404: 2394: 2393: 2392: 2391: 2390: 2389: 2211: 1985: 1934: 1903: 1877: 1862: 1839: 1765: 1599:Humans have a 1537: 1536: 1499: 1494: 1485: 1484: 1447: 1442: 1433: 1432: 1391: 1386: 1377: 1376: 1331: 1326: 1317: 1316: 1311: 1304: 1292: 1289: 1283: 1280: 1272:bacteriophages 1250:Main article: 1247: 1244: 1228:nervous system 1215:Main article: 1212: 1209: 1200:Main article: 1197: 1194: 1147:homeotic genes 1121:Main article: 1106: 1103: 1101: 1098: 1075: 1072: 1055: 1052: 1019: 1016: 982: 979: 963:hydrogen bonds 945: 942: 859: 842: 839: 795:Michael Levine 751: 748: 650: 649: 646: 645: 211: 205: 204: 199: 193: 192: 179: 173: 172: 162: 155: 154: 146: 145: 132: 126: 125: 120: 114: 113: 108: 102: 101: 96: 90: 89: 84: 77: 76: 71: 65: 64: 61: 57: 56: 52: 51: 34: 26: 25: 15: 9: 6: 4: 3: 2: 10961: 10950: 10947: 10945: 10942: 10940: 10937: 10935: 10932: 10930: 10927: 10925: 10922: 10921: 10919: 10906: 10901: 10895: 10892: 10890: 10887: 10886: 10884: 10880: 10872: 10871: 10867: 10866: 10865: 10862: 10860: 10857: 10855: 10852: 10850: 10847: 10845: 10842: 10838: 10835: 10834: 10833: 10832:Jacques Monod 10829: 10826: 10824: 10821: 10819: 10816: 10815: 10813: 10809: 10799: 10796: 10794: 10791: 10789: 10786: 10784: 10781: 10779: 10776: 10774: 10771: 10769: 10766: 10762: 10759: 10758: 10757: 10754: 10752: 10749: 10747: 10746:Homeotic gene 10744: 10743: 10741: 10737: 10731: 10728: 10726: 10723: 10721: 10718: 10716: 10713: 10711: 10708: 10706: 10703: 10701: 10698: 10697: 10695: 10691: 10688: 10684: 10678: 10675: 10673: 10670: 10668: 10665: 10663: 10660: 10658: 10655: 10654: 10652: 10648: 10642: 10639: 10637: 10634: 10632: 10629: 10625: 10622: 10620: 10617: 10616: 10615: 10614:Morphogenesis 10612: 10610: 10607: 10606: 10604: 10600: 10594: 10591: 10589: 10586: 10584: 10581: 10579: 10576: 10574: 10571: 10570: 10568: 10564: 10558: 10555: 10553: 10550: 10548: 10545: 10543: 10540: 10538: 10535: 10533: 10529: 10526: 10524: 10521: 10519: 10516: 10514: 10511: 10509: 10506: 10505: 10503: 10501: 10497: 10491: 10488: 10484: 10481: 10480: 10479: 10476: 10474: 10471: 10469: 10466: 10464: 10461: 10459: 10456: 10454: 10451: 10449: 10448:Reaction norm 10446: 10444: 10441: 10440: 10438: 10434: 10430: 10426: 10418: 10413: 10411: 10406: 10404: 10399: 10398: 10395: 10385: 10384: 10377: 10363: 10359: 10356: 10352: 10349: 10347: 10344: 10342: 10339: 10338: 10337: 10334: 10332: 10329: 10325: 10322: 10320: 10317: 10315: 10312: 10311: 10310: 10307: 10303: 10300: 10298: 10295: 10294: 10293: 10290: 10288: 10285: 10281: 10278: 10276: 10273: 10271: 10268: 10266: 10263: 10261: 10258: 10256: 10253: 10252: 10251: 10248: 10247: 10245: 10243: 10239: 10233: 10230: 10228: 10225: 10223: 10220: 10219: 10217: 10215: 10212: 10209: 10206: 10203: 10199: 10193: 10190: 10188: 10185: 10183: 10180: 10179: 10177: 10175: 10174:Pocket domain 10172: 10168: 10162: 10159: 10155: 10152: 10150: 10147: 10146: 10145: 10142: 10141: 10139: 10137: 10136:(0.2) HMGI(Y) 10133: 10129: 10125: 10120: 10116: 10100: 10097: 10095: 10092: 10090: 10087: 10085: 10082: 10080: 10077: 10075: 10072: 10071: 10070: 10067: 10066: 10064: 10062: 10058: 10052: 10049: 10047: 10044: 10043: 10041: 10039: 10035: 10029: 10026: 10025: 10023: 10021: 10017: 10009: 10006: 10004: 10001: 9999: 9996: 9994: 9991: 9990: 9989: 9986: 9982: 9979: 9975: 9972: 9970: 9967: 9965: 9962: 9961: 9960: 9957: 9956: 9955: 9952: 9950: 9947: 9945: 9942: 9938: 9935: 9933: 9930: 9928: 9925: 9923: 9920: 9918: 9915: 9913: 9910: 9908: 9905: 9903: 9900: 9898: 9895: 9893: 9890: 9888: 9885: 9883: 9880: 9878: 9875: 9873: 9870: 9868: 9865: 9863: 9860: 9859: 9858: 9855: 9851: 9848: 9846: 9843: 9842: 9841: 9838: 9834: 9831: 9829: 9826: 9824: 9821: 9819: 9816: 9815: 9814: 9811: 9807: 9804: 9802: 9799: 9797: 9794: 9792: 9789: 9788: 9787: 9784: 9782: 9779: 9778: 9776: 9774: 9771: 9767: 9761: 9758: 9756: 9753: 9752: 9750: 9748: 9745: 9741: 9735: 9732: 9728: 9725: 9723: 9720: 9718: 9715: 9713: 9710: 9709: 9708: 9705: 9704: 9702: 9700: 9697: 9693: 9687: 9684: 9680: 9677: 9675: 9672: 9670: 9667: 9665: 9662: 9660: 9657: 9655: 9652: 9650: 9647: 9645: 9642: 9640: 9637: 9635: 9632: 9631: 9630: 9627: 9623: 9620: 9618: 9615: 9613: 9610: 9609: 9608: 9605: 9604: 9602: 9600: 9596: 9588: 9585: 9583: 9580: 9578: 9575: 9573: 9570: 9568: 9565: 9563: 9560: 9559: 9558: 9555: 9554: 9552: 9550: 9547: 9543: 9535: 9532: 9530: 9527: 9525: 9522: 9520: 9517: 9515: 9512: 9511: 9510: 9507: 9503: 9500: 9498: 9495: 9493: 9490: 9488: 9485: 9483: 9480: 9479: 9478: 9475: 9474: 9472: 9470: 9467: 9463: 9459: 9455: 9449: 9445: 9429: 9426: 9424: 9421: 9419: 9416: 9414: 9411: 9410: 9409: 9406: 9405: 9403: 9401: 9397: 9391: 9388: 9386: 9383: 9379: 9376: 9374: 9371: 9369: 9366: 9364: 9361: 9359: 9356: 9354: 9351: 9349: 9346: 9344: 9341: 9340: 9339: 9336: 9334: 9331: 9327: 9324: 9322: 9319: 9317: 9314: 9312: 9309: 9308: 9307: 9304: 9300: 9297: 9295: 9292: 9290: 9287: 9285: 9282: 9281: 9280: 9277: 9275: 9272: 9268: 9265: 9263: 9260: 9258: 9255: 9254: 9253: 9250: 9248: 9245: 9241: 9238: 9236: 9233: 9231: 9228: 9227: 9226: 9223: 9222: 9220: 9218: 9214: 9206: 9203: 9201: 9198: 9196: 9193: 9192: 9191: 9190: 9186: 9185: 9183: 9181: 9178: 9174: 9166: 9163: 9161: 9158: 9156: 9153: 9151: 9148: 9146: 9143: 9141: 9138: 9136: 9133: 9131: 9128: 9126: 9123: 9121: 9118: 9116: 9113: 9111: 9108: 9106: 9103: 9101: 9098: 9096: 9093: 9091: 9088: 9086: 9083: 9081: 9078: 9076: 9073: 9071: 9068: 9066: 9063: 9061: 9058: 9056: 9053: 9051: 9048: 9046: 9043: 9041: 9038: 9036: 9033: 9031: 9028: 9026: 9023: 9021: 9018: 9016: 9013: 9011: 9008: 9006: 9003: 9001: 8998: 8996: 8993: 8991: 8988: 8986: 8983: 8981: 8978: 8976: 8973: 8971: 8968: 8966: 8963: 8961: 8958: 8956: 8953: 8951: 8948: 8946: 8943: 8941: 8938: 8936: 8933: 8931: 8928: 8926: 8923: 8922: 8921: 8918: 8914: 8911: 8909: 8906: 8904: 8901: 8899: 8896: 8894: 8891: 8890: 8889: 8886: 8885: 8883: 8881: 8877: 8874: 8870: 8860: 8857: 8855: 8852: 8850: 8847: 8846: 8845: 8842: 8838: 8835: 8833: 8830: 8829: 8828: 8825: 8823: 8820: 8818: 8815: 8814: 8813: 8810: 8808: 8805: 8803: 8800: 8798: 8795: 8793: 8790: 8788: 8785: 8781: 8778: 8776: 8773: 8772: 8771: 8768: 8766: 8763: 8759: 8756: 8754: 8751: 8750: 8748: 8744: 8741: 8739: 8736: 8734: 8731: 8729: 8726: 8724: 8721: 8719: 8716: 8714: 8711: 8709: 8706: 8704: 8701: 8700: 8699: 8696: 8695: 8693: 8691: 8687: 8675: 8672: 8670: 8667: 8666: 8665: 8662: 8660: 8657: 8653: 8650: 8648: 8645: 8643: 8640: 8638: 8635: 8633: 8630: 8628: 8624: 8621: 8619: 8616: 8614: 8611: 8609: 8605: 8602: 8600: 8597: 8596: 8595: 8592: 8588: 8585: 8583: 8580: 8578: 8575: 8573: 8570: 8568: 8565: 8563: 8560: 8558: 8555: 8553: 8550: 8548: 8545: 8544: 8543: 8540: 8534: 8531: 8529: 8526: 8524: 8521: 8519: 8516: 8514: 8511: 8510: 8509: 8506: 8502: 8499: 8497: 8494: 8493: 8492: 8489: 8485: 8482: 8480: 8477: 8475: 8472: 8471: 8470: 8467: 8463: 8460: 8458: 8455: 8454: 8453: 8450: 8446: 8443: 8441: 8438: 8436: 8433: 8431: 8428: 8426: 8423: 8421: 8418: 8416: 8413: 8412: 8411: 8408: 8407: 8405: 8403: 8400: 8396: 8393: 8391: 8388: 8387: 8386: 8383: 8381: 8378: 8376: 8373: 8369: 8366: 8364: 8361: 8359: 8356: 8355: 8354: 8351: 8349: 8346: 8344: 8341: 8339: 8336: 8335: 8333: 8327: 8317: 8314: 8312: 8309: 8307: 8304: 8302: 8299: 8297: 8294: 8292: 8289: 8285: 8282: 8280: 8277: 8275: 8272: 8270: 8267: 8265: 8262: 8260: 8257: 8255: 8252: 8250: 8247: 8245: 8242: 8240: 8237: 8235: 8232: 8231: 8230: 8227: 8225: 8222: 8218: 8215: 8213: 8210: 8209: 8208: 8205: 8203: 8200: 8198: 8195: 8193: 8190: 8188: 8185: 8181: 8178: 8176: 8173: 8172: 8171: 8168: 8164: 8161: 8159: 8156: 8155: 8154: 8153: 8149: 8145: 8142: 8140: 8137: 8135: 8132: 8130: 8127: 8125: 8122: 8120: 8117: 8116: 8115: 8112: 8108: 8105: 8103: 8100: 8099: 8098: 8095: 8093: 8090: 8088: 8085: 8083: 8080: 8078: 8075: 8073: 8070: 8069: 8067: 8064: 8058: 8053: 8047: 8044: 8042: 8039: 8037: 8034: 8030: 8027: 8025: 8022: 8020: 8017: 8015: 8012: 8010: 8007: 8005: 8002: 8000: 7997: 7995: 7992: 7990: 7987: 7985: 7982: 7980: 7977: 7975: 7972: 7970: 7967: 7965: 7962: 7960: 7957: 7955: 7952: 7950: 7947: 7945: 7942: 7940: 7937: 7935: 7932: 7930: 7927: 7925: 7922: 7920: 7917: 7915: 7912: 7910: 7907: 7905: 7902: 7900: 7897: 7895: 7892: 7890: 7887: 7885: 7882: 7880: 7877: 7875: 7872: 7870: 7867: 7865: 7862: 7860: 7857: 7855: 7852: 7850: 7847: 7845: 7842: 7841: 7840: 7837: 7835: 7832: 7830: 7827: 7825: 7822: 7820: 7816: 7810: 7807: 7805: 7802: 7800: 7797: 7796: 7795: 7792: 7788: 7785: 7784: 7783: 7780: 7776: 7773: 7771: 7768: 7767: 7766: 7763: 7762: 7761: 7758: 7757: 7755: 7752: 7746: 7741: 7738: 7735: 7729: 7728: 7722: 7719: 7717: 7714: 7710: 7706: 7702: 7699: 7696: 7691: 7687: 7673: 7670: 7669: 7667: 7665: 7661: 7655: 7652: 7648: 7645: 7643: 7640: 7638: 7635: 7633: 7630: 7628: 7625: 7624: 7623: 7620: 7616: 7613: 7611: 7608: 7606: 7603: 7602: 7601: 7598: 7596: 7593: 7591: 7588: 7586: 7583: 7582: 7580: 7578: 7574: 7568: 7565: 7564: 7562: 7560: 7553: 7545: 7542: 7540: 7537: 7535: 7532: 7530: 7527: 7525: 7522: 7520: 7517: 7515: 7512: 7510: 7507: 7505: 7502: 7500: 7497: 7495: 7492: 7490: 7487: 7485: 7482: 7480: 7477: 7475: 7472: 7470: 7467: 7465: 7462: 7460: 7457: 7455: 7452: 7450: 7447: 7445: 7442: 7440: 7437: 7435: 7432: 7430: 7427: 7425: 7422: 7420: 7417: 7415: 7412: 7410: 7407: 7405: 7402: 7400: 7397: 7395: 7392: 7390: 7387: 7385: 7382: 7380: 7377: 7375: 7372: 7370: 7367: 7365: 7362: 7360: 7357: 7355: 7352: 7350: 7347: 7345: 7342: 7340: 7337: 7335: 7332: 7330: 7327: 7325: 7322: 7320: 7317: 7316: 7315: 7312: 7308: 7305: 7303: 7300: 7298: 7295: 7293: 7290: 7288: 7285: 7283: 7280: 7278: 7275: 7273: 7270: 7269: 7268: 7265: 7261: 7258: 7256: 7253: 7252: 7251: 7248: 7246: 7243: 7241: 7238: 7234: 7231: 7229: 7226: 7224: 7221: 7219: 7216: 7215: 7214: 7211: 7209: 7206: 7204: 7201: 7199: 7196: 7194: 7191: 7185: 7182: 7180: 7177: 7175: 7172: 7170: 7167: 7165: 7162: 7161: 7160: 7157: 7153: 7150: 7148: 7145: 7143: 7140: 7138: 7135: 7133: 7130: 7128: 7125: 7123: 7120: 7118: 7115: 7113: 7110: 7108: 7105: 7103: 7100: 7098: 7095: 7093: 7090: 7088: 7085: 7083: 7080: 7078: 7075: 7074: 7073: 7070: 7069: 7068: 7067:Sp/KLF family 7065: 7061: 7058: 7056: 7053: 7052: 7051: 7048: 7044: 7041: 7039: 7036: 7034: 7031: 7030: 7029: 7026: 7022: 7019: 7017: 7014: 7012: 7009: 7008: 7007: 7004: 7000: 6997: 6995: 6992: 6991: 6990: 6987: 6983: 6980: 6978: 6975: 6973: 6970: 6968: 6965: 6963: 6960: 6958: 6955: 6953: 6950: 6949: 6948: 6945: 6943: 6940: 6938: 6935: 6931: 6928: 6926: 6923: 6921: 6918: 6916: 6913: 6912: 6911: 6908: 6906: 6903: 6901: 6898: 6894: 6891: 6889: 6886: 6884: 6881: 6880: 6879: 6878: 6874: 6872: 6869: 6868: 6861: 6858: 6856: 6853: 6851: 6848: 6846: 6843: 6841: 6838: 6836: 6833: 6831: 6828: 6826: 6823: 6822: 6821: 6818: 6816: 6813: 6811: 6808: 6804: 6801: 6799: 6796: 6795: 6794: 6791: 6789: 6786: 6784: 6781: 6779: 6776: 6775: 6774: 6771: 6770: 6768: 6766: 6755: 6749: 6746: 6742: 6739: 6737: 6734: 6732: 6729: 6728: 6727: 6724: 6720: 6717: 6715: 6712: 6710: 6707: 6705: 6702: 6700: 6697: 6695: 6692: 6691: 6690: 6687: 6686: 6684: 6682: 6675: 6665: 6662: 6660: 6657: 6656: 6654: 6651: 6646: 6640: 6637: 6636: 6634: 6631: 6626: 6620: 6617: 6615: 6612: 6611: 6609: 6606: 6601: 6593: 6590: 6588: 6585: 6583: 6580: 6579: 6578: 6575: 6574: 6572: 6569: 6564: 6556: 6553: 6551: 6548: 6546: 6543: 6542: 6541: 6538: 6534: 6531: 6529: 6526: 6524: 6521: 6517: 6514: 6512: 6509: 6508: 6507: 6504: 6502: 6499: 6498: 6497: 6494: 6493: 6491: 6488: 6483: 6477: 6474: 6470: 6467: 6465: 6462: 6461: 6460: 6457: 6453: 6450: 6448: 6445: 6443: 6440: 6439: 6438: 6435: 6433: 6430: 6426: 6423: 6421: 6418: 6417: 6416: 6413: 6411: 6408: 6404: 6401: 6399: 6395: 6394: 6393: 6390: 6389: 6387: 6384: 6379: 6373: 6370: 6366: 6363: 6361: 6358: 6357: 6356: 6353: 6349: 6346: 6344: 6341: 6339: 6336: 6335: 6334: 6331: 6327: 6324: 6322: 6319: 6317: 6314: 6313: 6312: 6309: 6307: 6304: 6300: 6297: 6295: 6292: 6290: 6287: 6286: 6285: 6282: 6278: 6275: 6273: 6270: 6269: 6268: 6265: 6263: 6260: 6258: 6255: 6251: 6248: 6246: 6243: 6242: 6241: 6238: 6237: 6235: 6232: 6227: 6224: 6222: 6215: 6212: 6208: 6204: 6199: 6196: 6191: 6187: 6171: 6168: 6166: 6163: 6161: 6158: 6156: 6153: 6151: 6148: 6147: 6146: 6143: 6142: 6140: 6138: 6134: 6126: 6123: 6121: 6118: 6116: 6113: 6111: 6108: 6106: 6103: 6101: 6098: 6096: 6093: 6092: 6091: 6088: 6087: 6085: 6083: 6079: 6070: 6067: 6063: 6060: 6058: 6055: 6054: 6053: 6050: 6046: 6043: 6041: 6038: 6036: 6033: 6031: 6028: 6026: 6023: 6022: 6021: 6018: 6017: 6016: 6013: 6009: 6006: 6004: 6001: 5999: 5996: 5994: 5991: 5990: 5989: 5986: 5985: 5983: 5981: 5977: 5971: 5968: 5964: 5961: 5959: 5956: 5955: 5954: 5951: 5949: 5946: 5944: 5941: 5939: 5936: 5934: 5931: 5929: 5926: 5924: 5921: 5917: 5914: 5912: 5909: 5908: 5907: 5904: 5902: 5899: 5898: 5896: 5894: 5891: 5887: 5877: 5874: 5873: 5871: 5863: 5855: 5852: 5850: 5847: 5845: 5842: 5841: 5840: 5837: 5833: 5830: 5828: 5825: 5823: 5820: 5818: 5815: 5813: 5810: 5808: 5805: 5803: 5800: 5799: 5798: 5795: 5794: 5792: 5786: 5778: 5775: 5773: 5770: 5768: 5765: 5763: 5760: 5759: 5758: 5755: 5753: 5750: 5746: 5743: 5741: 5738: 5736: 5733: 5732: 5731: 5728: 5727: 5725: 5719: 5711: 5708: 5706: 5703: 5702: 5701: 5698: 5694: 5691: 5689: 5686: 5684: 5681: 5679: 5676: 5675: 5674: 5671: 5667: 5664: 5662: 5659: 5657: 5654: 5653: 5651: 5647: 5644: 5642: 5639: 5637: 5634: 5633: 5632: 5629: 5627: 5624: 5620: 5617: 5615: 5612: 5611: 5610: 5607: 5605: 5602: 5600: 5597: 5596: 5594: 5591: 5583: 5577: 5574: 5572: 5569: 5565: 5562: 5560: 5557: 5555: 5552: 5551: 5550: 5547: 5545: 5542: 5541: 5539: 5533: 5527: 5524: 5518: 5515: 5513: 5510: 5509: 5508: 5505: 5503: 5500: 5499: 5498: 5495: 5491: 5488: 5486: 5483: 5482: 5481: 5478: 5474: 5471: 5469: 5466: 5465: 5464: 5461: 5457: 5454: 5452: 5449: 5447: 5444: 5443: 5442: 5439: 5435: 5432: 5430: 5427: 5426: 5425: 5422: 5418: 5415: 5413: 5410: 5408: 5405: 5403: 5400: 5399: 5398: 5395: 5393: 5390: 5386: 5383: 5381: 5378: 5377: 5376: 5373: 5371: 5368: 5364: 5361: 5359: 5356: 5355: 5354: 5351: 5350: 5348: 5342: 5339: 5336: 5332: 5328: 5322: 5319: 5315: 5312: 5310: 5307: 5305: 5302: 5301: 5300: 5297: 5295: 5292: 5290: 5287: 5283: 5280: 5278: 5275: 5273: 5270: 5268: 5265: 5264: 5263: 5260: 5256: 5253: 5251: 5248: 5246: 5243: 5241: 5238: 5237: 5236: 5233: 5231: 5228: 5226: 5223: 5221: 5218: 5216: 5213: 5211: 5208: 5206: 5203: 5199: 5196: 5194: 5191: 5189: 5186: 5185: 5184: 5181: 5177: 5174: 5172: 5169: 5167: 5164: 5162: 5159: 5157: 5154: 5152: 5149: 5148: 5147: 5144: 5142: 5139: 5137: 5134: 5130: 5127: 5125: 5122: 5121: 5120: 5117: 5113: 5110: 5108: 5105: 5103: 5100: 5098: 5095: 5093: 5090: 5088: 5085: 5083: 5080: 5078: 5075: 5074: 5073: 5070: 5066: 5063: 5061: 5058: 5056: 5053: 5051: 5048: 5046: 5043: 5041: 5038: 5036: 5033: 5031: 5028: 5027: 5026: 5023: 5022: 5020: 5017: 5013: 5010: 5006: 5002: 4998: 4993: 4989: 4985: 4981: 4974: 4969: 4967: 4962: 4960: 4955: 4954: 4951: 4946: 4942: 4938: 4930: 4926: 4923: 4921: 4917: 4914: 4912: 4908: 4905: 4902: 4900: 4897: 4896: 4885: 4881: 4877: 4873: 4869: 4865: 4860: 4856: 4850: 4846: 4841: 4840: 4833: 4829: 4823: 4818: 4817: 4810: 4809: 4796: 4792: 4788: 4784: 4780: 4776: 4772: 4768: 4761: 4753: 4749: 4745: 4741: 4737: 4733: 4729: 4725: 4718: 4710: 4706: 4701: 4696: 4691: 4686: 4682: 4678: 4674: 4667: 4665: 4663: 4661: 4659: 4650: 4646: 4642: 4638: 4634: 4630: 4626: 4622: 4615: 4607: 4603: 4598: 4593: 4589: 4585: 4581: 4577: 4573: 4566: 4558: 4554: 4550: 4546: 4542: 4538: 4531: 4516: 4512: 4508: 4504: 4500: 4496: 4492: 4489:(5): 719–22. 4488: 4484: 4480: 4473: 4465: 4461: 4457: 4453: 4449: 4445: 4441: 4437: 4430: 4422: 4418: 4413: 4408: 4404: 4400: 4396: 4389: 4381: 4377: 4372: 4367: 4363: 4359: 4356:(6): 626–32. 4355: 4351: 4347: 4340: 4332: 4328: 4323: 4318: 4314: 4310: 4307:(4): 185–95. 4306: 4302: 4298: 4291: 4289: 4280: 4276: 4272: 4268: 4265:(4): 240–52. 4264: 4260: 4253: 4245: 4241: 4236: 4231: 4227: 4223: 4219: 4212: 4204: 4200: 4195: 4190: 4186: 4182: 4178: 4174: 4170: 4163: 4155: 4151: 4146: 4141: 4137: 4133: 4129: 4122: 4114: 4110: 4105: 4100: 4096: 4092: 4089:(2): 343–51. 4088: 4084: 4080: 4073: 4065: 4061: 4056: 4051: 4048:(6): 4862–8. 4047: 4043: 4039: 4032: 4024: 4020: 4015: 4010: 4006: 4002: 3999:(1): 257–64. 3998: 3994: 3990: 3983: 3975: 3971: 3966: 3961: 3957: 3953: 3949: 3945: 3941: 3934: 3926: 3922: 3917: 3912: 3908: 3904: 3901:(7): 1562–9. 3900: 3896: 3892: 3885: 3877: 3873: 3868: 3863: 3859: 3855: 3851: 3844: 3836: 3832: 3828: 3824: 3820: 3816: 3812: 3808: 3801: 3793: 3789: 3785: 3781: 3777: 3773: 3766: 3758: 3754: 3750: 3746: 3742: 3738: 3734: 3730: 3726: 3722: 3715: 3707: 3703: 3699: 3695: 3691: 3687: 3684:(2): 409–14. 3683: 3679: 3671: 3663: 3659: 3655: 3651: 3646: 3641: 3637: 3633: 3629: 3625: 3621: 3614: 3606: 3602: 3597: 3592: 3587: 3582: 3578: 3574: 3570: 3563: 3555: 3551: 3547: 3543: 3539: 3535: 3531: 3527: 3520: 3512: 3508: 3503: 3498: 3494: 3490: 3486: 3482: 3478: 3471: 3469: 3460: 3456: 3452: 3448: 3444: 3440: 3436: 3432: 3425: 3417: 3413: 3408: 3403: 3398: 3393: 3389: 3385: 3381: 3377: 3373: 3366: 3358: 3354: 3349: 3344: 3340: 3336: 3331: 3326: 3322: 3318: 3314: 3310: 3306: 3299: 3284: 3280: 3274: 3270: 3269: 3264: 3257: 3249: 3245: 3241: 3237: 3233: 3229: 3226:(8): 811–23. 3225: 3221: 3214: 3206: 3202: 3197: 3192: 3188: 3184: 3181:(7): 1562–9. 3180: 3176: 3172: 3165: 3157: 3153: 3148: 3143: 3139: 3135: 3131: 3127: 3123: 3116: 3100: 3096: 3092: 3086: 3071: 3064: 3057: 3042: 3038: 3034: 3030: 3026: 3022: 3018: 3014: 3010: 3006: 2999: 2991: 2987: 2983: 2979: 2975: 2971: 2967: 2963: 2955: 2947: 2943: 2938: 2933: 2928: 2923: 2919: 2915: 2911: 2907: 2903: 2896: 2888: 2884: 2880: 2876: 2872: 2868: 2864: 2860: 2856: 2852: 2845: 2830: 2826: 2822: 2816: 2808: 2804: 2799: 2794: 2790: 2786: 2782: 2778: 2774: 2767: 2759: 2755: 2751: 2747: 2743: 2739: 2732: 2724: 2720: 2716: 2712: 2708: 2704: 2697: 2695: 2685: 2671:on 2019-12-21 2670: 2666: 2662: 2656: 2648: 2644: 2640: 2636: 2632: 2628: 2621: 2613: 2609: 2605: 2601: 2598:(8): 277–80. 2597: 2593: 2586: 2584: 2575: 2571: 2566: 2561: 2557: 2553: 2549: 2545: 2541: 2534: 2532: 2530: 2521: 2517: 2513: 2509: 2505: 2501: 2494: 2490: 2484: 2480: 2471: 2468: 2466: 2463: 2462: 2448: 2439: 2432: 2426: 2417: 2408: 2399: 2395: 2387: 2383: 2379: 2375: 2371: 2367: 2363: 2359: 2355: 2351: 2347: 2343: 2339: 2335: 2331: 2327: 2326: 2324: 2320: 2316: 2312: 2308: 2304: 2300: 2296: 2292: 2288: 2284: 2280: 2276: 2272: 2268: 2264: 2260: 2256: 2252: 2248: 2244: 2240: 2236: 2232: 2228: 2224: 2220: 2216: 2212: 2210: 2206: 2202: 2198: 2194: 2190: 2186: 2182: 2178: 2174: 2170: 2166: 2162: 2158: 2154: 2150: 2146: 2142: 2138: 2134: 2130: 2126: 2122: 2118: 2114: 2110: 2106: 2102: 2098: 2094: 2090: 2086: 2082: 2078: 2074: 2070: 2066: 2062: 2058: 2054: 2050: 2046: 2042: 2038: 2034: 2030: 2026: 2022: 2018: 2014: 2010: 2006: 2002: 1998: 1994: 1990: 1986: 1983: 1979: 1975: 1971: 1967: 1963: 1959: 1955: 1951: 1947: 1943: 1939: 1935: 1932: 1928: 1924: 1920: 1916: 1912: 1908: 1904: 1902: 1898: 1894: 1890: 1886: 1882: 1878: 1875: 1871: 1867: 1863: 1860: 1856: 1852: 1848: 1844: 1840: 1838: 1834: 1830: 1826: 1822: 1818: 1814: 1810: 1806: 1802: 1798: 1794: 1790: 1786: 1782: 1778: 1774: 1770: 1766: 1764: 1760: 1756: 1752: 1748: 1744: 1740: 1736: 1732: 1728: 1724: 1720: 1716: 1715: 1714: 1711: 1709: 1705: 1701: 1697: 1693: 1689: 1685: 1681: 1677: 1673: 1669: 1665: 1661: 1657: 1653: 1649: 1645: 1641: 1637: 1633: 1628: 1626: 1622: 1618: 1614: 1610: 1606: 1602: 1597: 1595: 1591: 1587: 1583: 1579: 1575: 1571: 1567: 1563: 1559: 1555: 1551: 1547: 1543: 1535: 1531: 1527: 1523: 1519: 1515: 1511: 1507: 1503: 1500: 1498: 1495: 1493: 1492: 1487: 1486: 1483: 1479: 1475: 1471: 1467: 1463: 1459: 1455: 1451: 1448: 1446: 1445:chromosome 12 1443: 1441: 1440: 1435: 1434: 1431: 1427: 1423: 1419: 1415: 1411: 1407: 1403: 1399: 1395: 1392: 1390: 1389:chromosome 17 1387: 1385: 1384: 1379: 1378: 1375: 1371: 1367: 1363: 1359: 1355: 1351: 1347: 1343: 1339: 1335: 1332: 1330: 1327: 1325: 1324: 1319: 1318: 1315: 1312: 1310: 1309: 1305: 1303: 1300: 1299: 1296: 1288: 1279: 1277: 1273: 1268: 1263: 1259: 1253: 1243: 1241: 1237: 1233: 1229: 1225: 1218: 1208: 1203: 1193: 1190: 1185: 1181: 1177: 1173: 1168: 1166: 1162: 1158: 1157: 1152: 1148: 1143: 1140: 1136: 1135: 1130: 1124: 1116: 1111: 1097: 1094: 1090: 1086: 1082: 1071: 1069: 1065: 1061: 1051: 1049: 1045: 1041: 1037: 1033: 1028: 1024: 1015: 1013: 1009: 1005: 1001: 997: 993: 988: 978: 976: 971: 968: 964: 960: 956: 951: 941: 938: 934: 930: 926: 922: 918: 914: 909: 907: 903: 899: 895: 891: 887: 883: 879: 878:alpha helices 875: 866: 858: 856: 852: 848: 838: 836: 832: 828: 824: 820: 816: 812: 808: 804: 800: 796: 792: 788: 784: 780: 779: 774: 773: 764: 760: 756: 747: 745: 741: 738: 734: 730: 726: 722: 718: 714: 711: 707: 703: 699: 696: 692: 688: 684: 680: 676: 675:morphogenesis 672: 667: 665: 662:, around 180 661: 657: 642: 636: 630: 624: 618: 612: 606: 600: 594: 588: 582: 576: 570: 564: 558: 552: 546: 540: 534: 528: 522: 516: 510: 504: 498: 492: 486: 480: 474: 468: 462: 456: 450: 444: 438: 432: 426: 420: 414: 408: 402: 396: 390: 384: 378: 372: 366: 360: 354: 348: 342: 336: 330: 324: 318: 312: 306: 300: 294: 288: 282: 276: 270: 264: 258: 252: 246: 240: 234: 228: 222: 216: 212: 210: 206: 203: 200: 198: 194: 191: 187: 183: 180: 178: 174: 170: 166: 163: 160: 156: 151: 147: 144: 140: 136: 133: 131: 127: 124: 121: 119: 115: 112: 109: 107: 103: 100: 97: 95: 91: 88: 85: 82: 78: 75: 72: 70: 66: 62: 58: 53: 48: 44: 43: 38: 32: 27: 22: 19: 10868: 10761:eyeless gene 10719: 10657:Evolvability 10631:Segmentation 10508:Canalisation 10478:Heterochrony 10468:Heritability 10436:Key concepts 10380: 10335: 10291: 10249: 10241: 10213: 10207: 10201: 10170: 10135: 10123: 10060: 10037: 10019: 9987: 9958: 9839: 9769: 9743: 9695: 9598: 9545: 9465: 9453: 9407: 9399: 9305: 9251: 9224: 9216: 9187: 9176: 8920:FOX proteins 8880:winged helix 8872: 8843: 8826: 8769: 8689: 8663: 8541: 8507: 8490: 8468: 8451: 8384: 8352: 8206: 8169: 8150: 8096: 8062: 8056: 7838: 7750: 7744: 7733: 7727:Antennapedia 7725: 7712: 7700: 7694: 7663: 7621: 7599: 7576: 7555: 7313: 7266: 7212: 7158: 7071: 7049: 7027: 7005: 6988: 6946: 6875: 6757: 6725: 6677: 6649: 6629: 6604: 6567: 6533:Progesterone 6486: 6382: 6230: 6216: 6210: 6194: 6136: 6089: 6081: 5979: 5889: 5838: 5796: 5756: 5729: 5699: 5672: 5506: 5496: 5479: 5462: 5374: 5330: 5298: 5261: 5118: 5008: 4996: 4920:LIG_HOMEOBOX 4918:motif class 4867: 4863: 4838: 4815: 4770: 4766: 4760: 4727: 4723: 4717: 4680: 4676: 4627:(3): 212–9. 4624: 4620: 4614: 4579: 4575: 4565: 4540: 4536: 4530: 4519:. Retrieved 4486: 4482: 4472: 4439: 4435: 4429: 4402: 4398: 4388: 4353: 4349: 4339: 4304: 4300: 4262: 4258: 4252: 4225: 4221: 4211: 4176: 4172: 4162: 4135: 4131: 4121: 4086: 4082: 4072: 4045: 4041: 4031: 3996: 3992: 3982: 3947: 3943: 3933: 3898: 3894: 3884: 3857: 3853: 3843: 3813:(1): 19–25. 3810: 3806: 3800: 3775: 3771: 3765: 3724: 3720: 3714: 3681: 3677: 3670: 3627: 3623: 3613: 3576: 3572: 3562: 3532:(1): 31–45. 3529: 3525: 3519: 3484: 3480: 3434: 3430: 3424: 3379: 3375: 3365: 3312: 3308: 3298: 3287:. Retrieved 3267: 3256: 3223: 3219: 3213: 3178: 3174: 3164: 3129: 3125: 3115: 3103:. Retrieved 3099:the original 3094: 3085: 3074:. Retrieved 3061:Bürglin TR. 3056: 3045:. Retrieved 3015:(2): 403–8. 3012: 3008: 2998: 2965: 2961: 2954: 2909: 2905: 2895: 2854: 2850: 2844: 2833:. Retrieved 2824: 2815: 2780: 2776: 2766: 2744:(1): 25–48. 2741: 2737: 2731: 2706: 2702: 2684: 2673:. Retrieved 2669:the original 2664: 2661:"Homeoboxes" 2655: 2630: 2626: 2620: 2595: 2591: 2547: 2543: 2503: 2499: 2483: 2447: 2438: 2425: 2416: 2407: 2398: 1879:SINE-class: 1841:CERS-class: 1712: 1629: 1598: 1540: 1497:chromosome 2 1489: 1437: 1381: 1329:chromosome 7 1321: 1313: 1306: 1301: 1294: 1285: 1276:lambda phage 1255: 1224:segmentation 1220: 1205: 1180:angiogenesis 1169: 1164: 1156:Antennapedia 1154: 1144: 1132: 1126: 1114: 1077: 1063: 1057: 1030:inhibitory. 1021: 1012:pluripotency 984: 947: 917:lambda phage 910: 908:of the DNA. 906:major groove 886:antiparallel 871: 847:protein fold 844: 831:phylogenetic 791:antennapedia 790: 786: 783:antennapedia 782: 778:antennapedia 776: 770: 768: 763:antennapedia 762: 758: 736: 725:antennapedia 715: 706:protein fold 694: 668: 660:DNA sequence 655: 653: 40: 37:Antennapedia 18: 10859:Mike Levine 10768:Distal-less 10593:Polyphenism 10573:Epigenetics 10425:development 10061:(4.11) Runt 7716:Homeodomain 7314:zinc finger 6650:subfamily 0 6630:subfamily 6 6605:subfamily 5 6568:subfamily 4 6487:subfamily 3 6383:subfamily 2 6231:subfamily 1 6198:Zinc finger 5441:Neurogenins 5009:(1.1) Basic 4677:BMC Biology 4537:Development 3772:Development 3382:(1): e153. 2213:NKL-class: 1987:PRD-class: 1905:CUT-class: 1864:HNF-class: 1767:POU-class: 1717:LIM-class: 1184:endothelial 1050:structure. 970:hydrophobic 921:prokaryotes 904:within the 898:side chains 823:Bloomington 811:Switzerland 744:vertebrates 695:homeodomain 63:Homeodomain 55:Identifiers 24:Homeodomain 10918:Categories 10837:Lac operon 10662:Robustness 10641:Modularity 10636:Metamerism 10542:Plasticity 10537:Pleiotropy 10490:Heterotopy 8594:POU domain 7734:ANTP class 7664:(2.6) WRKY 6947:GLI family 6082:(1.5) RF-X 5980:(1.4) NF-1 4521:2019-12-11 3950:: 167–76. 3596:10023/8685 3289:2008-02-27 3076:2010-01-30 3047:2019-12-09 2835:2019-12-09 2675:2019-11-20 2544:Chromosoma 2476:References 1936:ZF-class: 1308:chromosome 1252:POU family 1202:LIM domain 1189:hemangioma 1165:Drosophila 1064:Drosophila 1060:phenotypic 1032:Drosophila 1018:Regulation 913:eukaryotes 890:C-terminal 882:N-terminal 851:amino acid 835:bilaterian 787:Drosophila 772:Drosophila 759:Drosophila 737:Drosophila 691:eukaryotes 664:base pairs 165:structures 10788:Morphogen 10773:Engrailed 10756:Pax genes 10677:Tinkering 10523:Epistasis 10518:Dominance 10429:phenotype 10381:see also 10222:Apetala 2 8876:Fork head 7556:(2.4) Cys 6758:(2.3) Cys 5490:Scleraxis 4945:IPR001356 4683:(1): 47. 3605:2296-701X 2496:​; 2470:Body plan 2431:Pax genes 1991:(CART1), 1246:POU genes 1217:Pax genes 1211:Pax genes 1196:LIM genes 1105:Hox genes 1089:Paleozoic 1074:Evolution 1068:evolution 1054:Mutations 1048:chromatin 1040:trithorax 1027:microRNAs 1023:Hox genes 967:Conserved 855:consensus 837:animals. 761:with the 750:Discovery 638:​, 632:​, 626:​, 620:​, 614:​, 608:​, 602:​, 596:​, 590:​, 584:​, 578:​, 572:​, 566:​, 560:​, 554:​, 548:​, 542:​, 536:​, 530:​, 524:​, 518:​, 512:​, 506:​, 500:​, 494:​, 488:​, 482:​, 476:​, 470:​, 464:​, 458:​, 452:​, 446:​, 440:​, 434:​, 428:​, 422:​, 416:​, 410:​, 404:​, 398:​, 392:​, 386:​, 380:​, 374:​, 368:​, 362:​, 356:​, 350:​, 344:​, 338:​, 332:​, 326:​, 320:​, 314:​, 308:​, 302:​, 296:​, 290:​, 284:​, 278:​, 272:​, 266:​, 260:​, 254:​, 248:​, 242:​, 236:​, 230:​, 224:​, 218:​, 123:PDOC00027 99:IPR001356 10751:Hox gene 10739:Elements 10720:Homeobox 9699:MADS box 7839:Homeobox 7751:Hox-like 7745:protoHOX 6506:Estrogen 6501:Androgen 6355:Rev-ErbA 5893:bHLH-ZIP 5868:bHLH-COE 5407:Myogenin 4941:InterPro 4925:Homeobox 4907:Archived 4884:17098381 4795:32619323 4787:16688724 4752:11144283 4709:17963489 4641:17501745 4515:Archived 4511:44613005 4456:15520811 4421:15757903 4380:19458547 4331:19262140 4279:16379594 4244:15914537 4203:12466126 4154:15545924 4113:10648567 4064:14610084 3974:25979369 3925:25953647 3876:11073881 3827:10199961 3706:30114443 3662:17558233 3654:12445403 3554:44396110 3546:23799629 3511:19734295 3459:42823485 3451:16341069 3416:17252055 3376:PLOS ONE 3283:Archived 3248:17159381 3240:24996520 3205:25953647 3105:27 March 3070:Archived 3041:Archived 3037:40456645 2990:30114443 2829:Archived 2723:53188259 2574:26464018 2459:See also 1825:POU5F1P4 1821:POU5F1P1 1236:skeletal 1161:bithorax 1129:metazoan 1123:Hox gene 1085:Bilatera 1081:Cnidaria 1036:polycomb 955:arginine 740:homeotic 717:Homeosis 656:homeobox 182:RCSB PDB 94:InterPro 10882:Debates 10693:Systems 10619:Eyespot 10483:Neoteny 10099:RUNX1T1 10079:CBFA2T3 10074:CBFA2T2 9954:TCF/LEF 8063:NK-like 8057:metaHOX 7760:ParaHox 7701:domains 6392:COUP-TF 5866:Group F 5789:Group E 5722:Group D 5586:Group C 5536:Group B 5480:Paraxis 5345:Group A 4732:Bibcode 4700:2211742 4649:9530210 4606:9336443 4557:1687460 4503:1591773 4464:6030950 4371:2728585 4322:2634105 4194:1850921 4104:2174277 4023:9314544 4014:2139816 3965:4592147 3916:4754957 3835:3192774 3792:8898214 3757:4320668 3749:3821869 3729:Bibcode 3698:6327066 3632:Bibcode 3502:2775110 3407:1779807 3384:Bibcode 3357:9391098 3317:Bibcode 3196:4754957 3156:1357628 3029:6327065 2982:6327066 2946:6330741 2914:Bibcode 2887:4235713 2879:6323992 2859:Bibcode 2807:6416827 2758:2568852 2709:: 3–6. 2647:7903947 2612:1357790 2565:4901127 2520:7903398 2027:, DUX ( 1915:ONECUT3 1911:ONECUT2 1907:ONECUT1 1708:TGIF2LY 1704:TGIF2LX 1542:ParaHox 1488:HOXD - 1436:HOXC - 1380:HOXB - 1172:paralog 1151:ectopia 1134:Xenopus 1000:tissues 933:glycine 805:of the 733:animals 698:protein 679:animals 644:​ 118:PROSITE 111:SM00389 74:PF00046 10783:Ligand 10463:Operon 8812:Bicoid 8077:BARHL2 8072:BARHL1 7654:JMJD1B 7567:HIVEP1 6052:I-SMAD 6020:R-SMAD 5938:MLXIPL 5693:Period 5619:ARNTL2 5424:NeuroD 4931:(MeSH) 4882:  4851:  4824:  4793:  4785:  4750:  4707:  4697:  4647:  4639:  4604:  4597:147054 4594:  4555:  4509:  4501:  4462:  4454:  4419:  4378:  4368:  4329:  4319:  4277:  4242:  4201:  4191:  4152:  4111:  4101:  4062:  4021:  4011:  3972:  3962:  3923:  3913:  3874:  3833:  3825:  3790:  3755:  3747:  3721:Nature 3704:  3696:  3660:  3652:  3603:  3552:  3544:  3509:  3499:  3457:  3449:  3414:  3404:  3355:  3345:  3337:  3275:  3246:  3238:  3203:  3193:  3154:  3147:334173 3144:  3035:  3027:  2988:  2980:  2944:  2937:345379 2934:  2885:  2877:  2851:Nature 2805:  2798:555405 2795:  2756:  2721:  2645:  2610:  2572:  2562:  2518:  2386:NKX6-3 2382:NKX6-2 2378:NKX6-1 2362:NKX2-6 2358:NKX2-5 2354:NKX2-3 2350:NKX3-2 2346:NKX3-1 2342:NKX2-8 2338:NKX2-2 2334:NKX2-4 2330:NKX2-1 2328:Nkx: 2219:BARHL2 2215:BARHL1 2177:RHOXF2 2173:RHOXF1 2137:PHOX2B 2133:PHOX2A 1866:HMBOX1 1837:POU6F2 1835:; and 1833:POU6F1 1829:POU5F2 1817:POU5F1 1813:POU4F3 1809:POU4F2 1805:POU4F1 1801:POU3F4 1797:POU3F3 1793:POU3F2 1789:POU3F1 1785:POU2F3 1781:POU2F2 1777:POU2F1 1773:POU1F1 1692:PKNOX2 1688:PKNOX1 1623:, and 1592:; and 1564:; and 1534:HOXD13 1530:HOXD12 1526:HOXD11 1522:HOXD10 1482:HOXC13 1478:HOXC12 1474:HOXC11 1470:HOXC10 1430:HOXB13 1374:HOXA13 1370:HOXA11 1366:HOXA10 1004:organs 959:lysine 937:steric 801:, and 687:plants 197:PDBsum 171:  161:  143:SUPFAM 87:CL0123 60:Symbol 10924:Genes 10362:Sigma 10227:EREBP 10211:EREBP 10202:(0.5) 10171:(0.3) 10094:RUNX3 10089:RUNX2 10084:RUNX1 10028:TFCP2 9949:SSRP1 9770:(4.7) 9760:TBPL1 9744:(4.6) 9696:(4.4) 9546:(4.2) 9487:NFKB2 9482:NFKB1 9477:NF-κB 9466:(4.1) 9390:MYBL2 9177:(3.4) 8873:(3.3) 8822:BICD2 8797:SHOX2 8765:PROP1 8749:PRRX 8659:SATB2 8604:BRN-3 8599:PIT-1 8491:PKNOX 8406:TALE 8402:NOBOX 8375:HESX1 8348:CUTL1 8330:other 8224:NANOG 8087:BARX2 8082:BARX1 7834:MEOX2 7829:MEOX1 7713:(3.1) 7622:JARID 7595:GRLF1 7590:DIDO1 7250:Zbtb7 7240:TSHZ3 7208:PRDM9 7006:HIVEP 6871:ATBF1 6825:TFIIH 6810:TFIIF 6793:TFIIE 6788:TFIID 6783:TFIIB 6778:TFIIA 6748:TRPS1 6614:LRH-1 6592:NURR1 6582:NGFIB 6410:Ear-2 6211:(2.1) 5953:SREBP 5890:(1.3) 5652:NPAS 5641:EPAS1 5626:CLOCK 5614:ARNTL 5588:bHLH- 5564:n-Myc 5559:l-Myc 5554:c-Myc 5544:FIGLA 5526:Twist 5485:TCF15 5392:MESP2 5370:ATOH1 5363:ASCL2 5358:ASCL1 5289:NFIL3 5220:GABPA 5215:DDIT3 5146:C/EBP 5141:BLZF1 5102:c-Jun 5092:FOSL2 5087:FOSL1 5077:c-Fos 4847:–66. 4791:S2CID 4645:S2CID 4507:S2CID 4460:S2CID 3831:S2CID 3753:S2CID 3702:S2CID 3658:S2CID 3550:S2CID 3455:S2CID 3348:28378 3339:43805 3335:JSTOR 3244:S2CID 3066:(gif) 3033:S2CID 2986:S2CID 2883:S2CID 2719:S2CID 2323:VENTX 2311:TSHZ3 2307:TSHZ2 2303:TSHZ1 2283:NANOG 2227:BARX2 2223:BARX1 2197:TPRX1 2193:SHOX2 2185:SEBOX 2161:PRRX2 2157:PRRX1 2153:PROP1 2149:PITX3 2145:PITX2 2141:PITX1 2085:NOBOX 2081:MIXL1 2077:LEUTX 2065:HESX1 2009:DMBX1 2001:ARGFX 1982:HOMEZ 1974:ZFHX4 1970:ZFHX3 1966:ZFHX2 1954:TSHZ3 1950:TSHZ2 1946:TSHZ1 1942:ADNP2 1931:SATB2 1927:SATB1 1874:HNF1B 1870:HNF1A 1859:LASS6 1855:LASS5 1851:LASS4 1847:LASS3 1843:LASS2 1763:LMX1B 1759:LMX1A 1700:TGIF2 1696:TGIF1 1664:MEIS3 1660:MEIS2 1656:MEIS1 1590:MEOX2 1586:MEOX1 1518:HOXD9 1514:HOXD8 1510:HOXD4 1506:HOXD3 1502:HOXD1 1491:HOXD@ 1466:HOXC9 1462:HOXC8 1458:HOXC6 1454:HOXC5 1450:HOXC4 1439:HOXC@ 1426:HOXB9 1422:HOXB8 1418:HOXB7 1414:HOXB6 1410:HOXB5 1406:HOXB4 1402:HOXB3 1398:HOXB2 1394:HOXB1 1383:HOXB@ 1362:HOXA9 1358:HOXA7 1354:HOXA6 1350:HOXA5 1346:HOXA4 1342:HOXA3 1338:HOXA2 1334:HOXA1 1323:HOXA@ 1240:Pax 6 1008:NANOG 950:B-DNA 902:bases 683:fungi 677:) in 671:genes 658:is a 139:SCOPe 130:SCOP2 106:SMART 10423:The 10331:MNDA 10250:ARID 10205:AP-2 10192:RBL2 10187:RBL1 10161:HBP1 10144:HMGA 10051:YBX1 10046:CSDA 9981:LEF1 9813:HMGN 9786:HMGB 9707:Mef2 9686:MYRF 9674:TBR2 9669:TBR1 9617:TP63 9557:STAT 9549:STAT 9509:NFAT 9502:RELB 9497:RELA 9452:(4) 9333:FLI1 9299:SPIB 9000:D4L6 8995:D4L5 8990:D4L4 8985:D4L3 8980:D4L1 8844:PITX 8807:VSX2 8802:VSX1 8792:SHOX 8770:PHOX 8452:MEIS 8380:HOPX 8316:VAX2 8311:VAX1 8306:TLX3 8301:TLX2 8296:TLX1 8291:NATO 8274:HMX3 8269:HMX2 8264:HMX1 8202:LBX2 8197:LBX1 8187:HHEX 8046:MNX1 8041:GBX2 8036:GBX1 7824:Evx2 7819:Evx1 7787:PDX1 7782:Xlox 7672:WRKY 7585:AIRE 7544:804A 7267:ZBTB 7213:SALL 7203:OSR1 7198:MYT1 7193:MTF1 7028:IKZF 6967:REST 6942:GFI1 6937:ERV3 6905:E4F1 6900:CTCF 6689:GATA 6659:DAX1 6639:GCNF 6587:NOR1 6415:HNF4 6284:PPAR 6217:(Cys 6145:AP-2 6015:SMAD 5970:USF1 5943:MXI1 5923:MITF 5916:MXD3 5911:MXD1 5901:AP-4 5876:EBF1 5752:Pho4 5730:BHLH 5609:ARNT 5604:AHRR 5576:TCF4 5571:MXD4 5502:LYL1 5463:OLIG 5417:MYF6 5412:MYF5 5402:MyoD 5375:HAND 5353:AS-C 5335:bHLH 5321:XBP1 5225:GCN4 5205:CREM 5183:CREB 5136:BATF 5119:BACH 5112:JunD 5107:JUNB 5097:JDP2 5082:FOSB 5072:AP-1 5030:AATF 5016:bZIP 4982:and 4939:and 4937:Pfam 4880:PMID 4864:Gene 4849:ISBN 4822:ISBN 4783:PMID 4748:PMID 4705:PMID 4637:PMID 4602:PMID 4553:PMID 4499:PMID 4483:Cell 4452:PMID 4417:PMID 4376:PMID 4327:PMID 4275:PMID 4240:PMID 4199:PMID 4150:PMID 4109:PMID 4060:PMID 4019:PMID 3970:PMID 3921:PMID 3872:PMID 3823:PMID 3788:PMID 3745:PMID 3694:PMID 3678:Cell 3650:PMID 3601:ISSN 3542:PMID 3507:PMID 3447:PMID 3412:PMID 3353:PMID 3273:ISBN 3236:PMID 3201:PMID 3152:PMID 3107:2018 3025:PMID 3009:Cell 2978:PMID 2962:Cell 2942:PMID 2875:PMID 2803:PMID 2754:PMID 2643:PMID 2627:Gene 2608:PMID 2570:PMID 2516:PMID 2493:1AHD 2451:Nk5. 2442:Nk4. 2429:The 2374:HMX3 2370:HMX2 2366:HMX1 2319:VAX2 2315:VAX1 2299:TLX3 2295:TLX2 2291:TLX1 2287:NOTO 2279:MSX2 2275:MSX1 2271:LBX2 2267:LBX1 2263:HLX1 2259:HHEX 2247:EMX2 2243:EMX1 2239:DBX2 2235:DBX1 2209:VSX2 2205:VSX1 2201:UNCX 2189:SHOX 2169:RAX2 2129:PAX8 2125:PAX7 2121:PAX6 2117:PAX5 2113:PAX4 2109:PAX3 2105:PAX2 2097:OTX2 2093:OTX1 2069:HOPX 2061:GSC2 2053:ESX1 2025:DUXB 2021:DUXA 2017:DRGX 2013:DPRX 1997:ALX4 1993:ALX3 1989:ALX1 1978:ZHX1 1962:ZEB2 1958:ZEB1 1938:ADNP 1923:CUX2 1919:CUX1 1901:SIX6 1897:SIX5 1893:SIX4 1889:SIX3 1885:SIX2 1881:SIX1 1755:LHX9 1751:LHX8 1747:LHX6 1743:LHX5 1739:LHX4 1735:LHX3 1731:LHX2 1727:LHX1 1723:ISL2 1719:ISL1 1684:PBX4 1680:PBX3 1676:PBX2 1672:PBX1 1652:IRX6 1648:IRX5 1644:IRX4 1640:IRX3 1636:IRX2 1632:IRX1 1625:DLX6 1621:DLX5 1617:DLX4 1613:DLX3 1609:DLX2 1605:DLX1 1594:MNX1 1582:GBX2 1578:GBX1 1574:EVX2 1570:EVX1 1566:PDX1 1562:GSX2 1558:GSX1 1554:CDX4 1550:CDX2 1546:CDX1 1314:gene 1302:name 1176:limb 1159:and 1038:and 1002:and 957:and 927:and 813:and 641:9ant 635:3hdd 629:2r5z 623:2r5y 617:2p81 611:2lfb 605:2jwt 599:2hoa 593:2hi3 587:2hdd 581:2h8r 575:2ecc 569:2ecb 563:2e1o 557:2dmq 551:2cuf 545:2cue 539:2cra 533:2cqx 527:1ztr 521:1zq3 515:1yz8 509:1yrn 503:1x2n 497:1x2m 491:1wi3 485:1vnd 479:1uhs 473:1san 467:1s7e 461:1qry 455:1puf 449:1pog 443:1p7j 437:1p7i 431:1oct 425:1ocp 419:1o4x 413:1nk3 407:1nk2 401:1mnm 395:1mh4 389:1mh3 383:1lfu 377:1lfb 371:1le8 365:1kz2 359:1k61 353:1jgg 347:1ig7 341:1ic8 335:1hom 329:1hf0 323:1hdp 317:1hdd 311:1gt0 305:1ftz 299:1ftt 293:1fjl 287:1f43 281:1enh 275:1e3o 269:1du6 263:1du0 257:1cqt 251:1bw5 245:1b8i 239:1b72 233:1au7 227:1apl 221:1akh 215:1ahd 190:PDBj 186:PDBe 169:ECOD 159:Pfam 135:1ahd 83:clan 81:Pfam 69:Pfam 35:The 10427:of 10358:Rho 10336:NFY 10309:MLL 10292:IFI 10287:CAP 10069:CBF 9988:TOX 9959:TCF 9944:SRY 9857:SOX 9840:HNF 9781:BBX 9755:TBP 9734:SRF 9679:TFT 9629:TBX 9622:p73 9612:p53 9492:REL 9385:MYB 9306:ETV 9294:ERG 9279:ETS 9274:ERF 9252:ELK 9247:EGF 9225:ELF 9189:HSF 8888:E2F 8827:OTX 8817:GSC 8787:RAX 8698:PAX 8664:ZEB 8637:3/4 8587:21A 8542:PHF 8508:SIX 8469:PBX 8445:MKX 8410:IRX 8385:LMX 8353:FHL 8343:CRX 8338:ARX 8284:6-2 8279:6-1 8259:3-2 8254:3-1 8249:2-5 8244:2-3 8239:2-2 8234:2-1 8229:NKX 8207:MSX 8192:HLX 8152:EMX 8114:DLX 8097:DBX 8092:BSX 8029:D13 8024:D12 8019:D11 8014:D10 7984:C13 7979:C12 7974:C11 7969:C10 7939:B13 7889:A13 7884:A11 7879:A10 7794:Cdx 7765:Gsx 7695:(3) 7600:ING 7539:655 7534:649 7529:644 7524:638 7519:593 7514:471 7509:452 7504:451 7499:423 7494:384 7489:366 7484:365 7479:350 7474:346 7469:330 7464:318 7459:300 7454:281 7449:268 7444:267 7439:259 7434:239 7429:238 7424:219 7419:217 7414:202 7409:165 7404:148 7399:146 7394:143 7354:33B 7245:WT1 7072:KLF 7050:ILF 6989:HIC 6982:YY1 6910:EGR 6893:11B 6888:11A 6877:BCL 6860:3C2 6855:3C1 6762:His 6726:MTA 6664:SHP 6619:SF1 6577:NUR 6476:TLX 6437:RXR 6432:PNR 6372:VDR 6333:ROR 6311:RAR 6306:PXR 6294:β/δ 6267:LXR 6262:FXR 6257:CAR 6195:(2) 6125:ANK 6090:RFX 5988:NFI 5948:Myc 5933:MLX 5928:MNT 5906:MAX 5839:HEY 5797:HES 5700:SIM 5673:PER 5631:HIF 5599:AhR 5590:PAS 5549:Myc 5507:TAL 5497:SLC 5299:NRF 5294:NRL 5262:NFE 5235:MAF 5230:HLF 5210:DBP 4872:doi 4868:387 4845:159 4775:doi 4771:140 4740:doi 4728:288 4695:PMC 4685:doi 4629:doi 4592:PMC 4584:doi 4545:doi 4541:113 4491:doi 4444:doi 4407:doi 4403:280 4366:PMC 4358:doi 4317:PMC 4309:doi 4267:doi 4230:doi 4226:118 4189:PMC 4181:doi 4177:161 4140:doi 4099:PMC 4091:doi 4087:148 4050:doi 4046:279 4009:PMC 4001:doi 3997:139 3960:PMC 3952:doi 3911:PMC 3903:doi 3862:doi 3815:doi 3811:296 3780:doi 3776:122 3737:doi 3725:325 3686:doi 3640:doi 3591:hdl 3581:doi 3534:doi 3497:PMC 3489:doi 3439:doi 3402:PMC 3392:doi 3343:PMC 3325:doi 3228:doi 3191:PMC 3183:doi 3142:PMC 3134:doi 3017:doi 2970:doi 2932:PMC 2922:doi 2867:doi 2855:308 2793:PMC 2785:doi 2746:doi 2742:989 2711:doi 2635:doi 2631:135 2600:doi 2560:PMC 2552:doi 2548:125 2508:doi 2504:234 2489:PDB 2255:EN2 2251:EN1 2231:BSX 2165:RAX 2101:CRX 2089:OTP 2073:ISX 2057:GSC 2051:); 2005:ARX 1769:HDX 1668:MKX 1163:in 1137:by 925:cro 894:DNA 821:in 809:in 710:DNA 209:PDB 177:PDB 47:DNA 10920:: 10830:+ 10324:T1 10302:35 10297:16 10280:4A 10275:3B 10270:3A 10260:1B 10255:1A 10232:B3 10182:Rb 9937:21 9932:18 9927:15 9922:14 9917:13 9912:12 9907:11 9902:10 9850:1B 9845:1A 9664:22 9659:21 9654:19 9529:C4 9524:C3 9519:C2 9514:C1 9165:S1 9160:R2 9155:R1 9150:Q1 9145:P4 9140:P3 9135:P2 9130:P1 9125:O6 9120:O4 9115:O3 9110:O1 9105:N4 9100:N3 9095:N2 9090:N1 9085:M1 9080:L2 9075:L1 9070:K2 9065:K1 9060:J3 9055:J2 9050:J1 9045:I3 9040:I2 9035:I1 9030:H1 9025:G1 9020:F2 9015:F1 9010:E3 9005:E1 8975:D4 8970:D3 8965:D2 8960:D1 8955:C2 8950:C1 8945:B2 8940:B1 8935:A3 8930:A2 8925:A1 8878:/ 8780:2B 8775:2A 8652:11 8625:: 8606:: 8582:20 8577:17 8572:16 8567:10 8395:1B 8390:1A 8170:EN 8009:D9 8004:D8 7999:D4 7994:D3 7989:D1 7964:C9 7959:C8 7954:C6 7949:C5 7944:C4 7934:B9 7929:B8 7924:B7 7919:B6 7914:B5 7909:B4 7904:B3 7899:B2 7894:B1 7874:A9 7869:A7 7864:A5 7859:A4 7854:A3 7849:A2 7844:A1 7642:1D 7637:1C 7632:1B 7627:1A 7389:74 7384:51 7379:44 7374:43 7369:41 7364:35 7359:34 7349:24 7344:22 7339:19 7334:10 7307:40 7302:33 7297:32 7292:21 7287:20 7282:17 7277:16 7272:11 7260:7B 7255:7A 7159:SP 7152:17 7147:15 7142:14 7137:13 7132:12 7127:11 7122:10 6977:S2 6972:S1 6850:3A 6845:2I 6403:II 5757:ID 5646:3A 5636:1A 5282:L3 5277:L2 5272:L1 5198:L1 4943:: 4878:. 4866:. 4789:. 4781:. 4769:. 4746:. 4738:. 4726:. 4703:. 4693:. 4679:. 4675:. 4657:^ 4643:. 4635:. 4623:. 4600:. 4590:. 4580:25 4578:. 4574:. 4551:. 4539:. 4513:. 4505:. 4497:. 4487:69 4485:. 4481:. 4458:. 4450:. 4438:. 4415:. 4401:. 4397:. 4374:. 4364:. 4354:68 4352:. 4348:. 4325:. 4315:. 4303:. 4299:. 4287:^ 4273:. 4261:. 4238:. 4224:. 4220:. 4197:. 4187:. 4175:. 4171:. 4148:. 4136:24 4134:. 4130:. 4107:. 4097:. 4085:. 4081:. 4058:. 4044:. 4040:. 4017:. 4007:. 3995:. 3991:. 3968:. 3958:. 3948:67 3946:. 3942:. 3919:. 3909:. 3899:35 3897:. 3893:. 3870:. 3858:87 3856:. 3852:. 3829:. 3821:. 3809:. 3786:. 3774:. 3751:. 3743:. 3735:. 3723:. 3700:. 3692:. 3682:37 3680:. 3656:. 3648:. 3638:. 3628:12 3626:. 3622:. 3599:. 3589:. 3579:. 3575:. 3571:. 3548:. 3540:. 3528:. 3505:. 3495:. 3485:26 3483:. 3479:. 3467:^ 3453:. 3445:. 3433:. 3410:. 3400:. 3390:. 3378:. 3374:. 3351:. 3341:. 3333:. 3323:. 3313:94 3311:. 3307:. 3281:. 3265:. 3242:. 3234:. 3224:92 3222:. 3199:. 3189:. 3179:35 3177:. 3173:. 3150:. 3140:. 3130:20 3128:. 3124:. 3093:. 3039:. 3031:. 3023:. 3013:37 3011:. 3007:. 2984:. 2976:. 2966:37 2964:. 2940:. 2930:. 2920:. 2910:81 2908:. 2904:. 2881:. 2873:. 2865:. 2853:. 2827:. 2823:. 2801:. 2791:. 2779:. 2775:. 2752:. 2740:. 2717:. 2707:10 2705:. 2693:^ 2663:. 2641:. 2629:. 2606:. 2596:17 2594:. 2582:^ 2568:. 2558:. 2546:. 2542:. 2528:^ 2514:. 2502:. 2491:: 2384:; 2380:; 2376:; 2372:, 2368:, 2364:; 2360:, 2356:, 2352:; 2348:, 2344:; 2340:, 2336:; 2332:, 2325:; 2321:, 2317:, 2313:; 2309:, 2305:, 2301:; 2297:, 2293:, 2289:; 2285:; 2281:; 2277:, 2273:; 2269:, 2265:; 2261:; 2257:; 2253:, 2249:; 2245:, 2241:; 2237:, 2233:; 2229:; 2225:, 2221:; 2217:, 2207:, 2203:; 2199:; 2195:; 2191:, 2187:; 2183:; 2181:2B 2175:, 2171:; 2167:, 2163:; 2159:, 2155:; 2151:; 2147:, 2143:, 2139:; 2135:, 2131:; 2127:, 2123:, 2119:, 2115:, 2111:, 2107:, 2103:; 2099:, 2095:, 2091:; 2087:; 2083:; 2079:; 2075:; 2071:; 2067:; 2063:; 2059:, 2055:; 2047:, 2045:4c 2043:, 2039:, 2035:, 2031:, 2023:, 2019:; 2015:; 2011:; 2007:; 2003:; 1999:; 1995:, 1980:, 1976:; 1972:, 1968:, 1964:; 1960:, 1956:; 1952:, 1948:, 1944:; 1940:, 1929:, 1925:; 1921:, 1917:; 1913:, 1909:, 1899:, 1895:, 1891:, 1887:, 1883:, 1872:, 1868:; 1857:, 1853:, 1849:, 1845:, 1831:; 1827:; 1823:; 1819:; 1815:; 1811:; 1807:; 1803:; 1799:; 1795:; 1791:; 1787:; 1783:; 1779:; 1775:; 1771:; 1761:, 1757:; 1753:, 1749:, 1745:, 1741:, 1737:, 1733:, 1729:, 1725:; 1721:, 1710:. 1706:, 1702:, 1698:, 1694:; 1690:, 1686:; 1682:, 1678:, 1674:, 1670:; 1666:; 1662:, 1658:, 1654:; 1650:, 1646:, 1642:, 1638:, 1634:, 1619:, 1615:, 1611:, 1607:, 1603:: 1588:, 1584:; 1580:, 1576:; 1572:, 1560:, 1556:; 1552:, 1548:, 1532:, 1528:, 1524:, 1520:, 1516:, 1512:, 1508:, 1504:, 1480:, 1476:, 1472:, 1468:, 1464:, 1460:, 1456:, 1452:, 1428:, 1424:, 1420:, 1416:, 1412:, 1408:, 1404:, 1400:, 1396:, 1372:, 1368:, 1364:, 1360:, 1356:, 1352:, 1348:, 1344:, 1340:, 1336:, 1278:. 1234:, 1226:, 861:60 797:, 746:. 685:, 681:, 654:A 188:; 184:; 167:/ 141:/ 137:/ 10530:/ 10416:e 10409:t 10402:v 10360:/ 10351:C 10346:B 10341:A 10319:3 10314:2 10265:2 10208:/ 10154:2 10149:1 10008:4 10003:3 9998:2 9993:1 9974:4 9969:3 9964:1 9897:9 9892:8 9887:6 9882:5 9877:4 9872:3 9867:2 9862:1 9833:4 9828:3 9823:2 9818:1 9806:4 9801:3 9796:2 9791:1 9727:D 9722:C 9717:B 9712:A 9649:5 9644:3 9639:2 9634:1 9587:6 9582:5 9577:4 9572:3 9567:2 9562:1 9534:5 9428:4 9423:3 9418:2 9413:1 9378:8 9373:7 9368:6 9363:5 9358:4 9353:3 9348:2 9343:1 9326:6 9321:5 9316:4 9311:1 9289:2 9284:1 9267:4 9262:3 9257:1 9240:5 9235:4 9230:2 9205:4 9200:2 9195:1 8913:5 8908:4 8903:3 8898:2 8893:1 8859:3 8854:2 8849:1 8837:2 8832:1 8758:2 8753:1 8743:9 8738:8 8733:7 8728:6 8723:5 8718:4 8713:3 8708:2 8703:1 8674:2 8669:1 8647:7 8642:6 8632:2 8627:1 8618:C 8613:B 8608:A 8562:8 8557:6 8552:3 8547:1 8533:5 8528:4 8523:3 8518:2 8513:1 8501:2 8496:1 8484:3 8479:2 8474:1 8462:2 8457:1 8440:6 8435:5 8430:4 8425:3 8420:2 8415:1 8368:3 8363:2 8358:1 8217:2 8212:1 8180:2 8175:1 8163:2 8158:1 8144:6 8139:5 8134:4 8129:3 8124:2 8119:1 8107:2 8102:1 7809:4 7804:2 7799:1 7775:2 7770:1 7647:2 7615:4 7610:2 7605:1 7558:6 7329:9 7324:7 7319:3 7233:4 7228:3 7223:2 7218:1 7184:8 7179:7 7174:4 7169:2 7164:1 7117:9 7112:8 7107:7 7102:6 7097:5 7092:4 7087:3 7082:2 7077:1 7060:3 7055:2 7043:3 7038:2 7033:1 7021:3 7016:2 7011:1 6999:2 6994:1 6962:3 6957:2 6952:1 6930:4 6925:3 6920:2 6915:1 6883:6 6840:4 6835:2 6830:1 6820:2 6815:1 6803:2 6798:1 6764:2 6760:2 6741:3 6736:2 6731:1 6719:6 6714:5 6709:4 6704:3 6699:2 6694:1 6680:4 6555:γ 6550:β 6545:α 6516:β 6511:α 6469:4 6464:2 6452:γ 6447:β 6442:α 6425:γ 6420:α 6398:I 6396:( 6365:β 6360:α 6348:γ 6343:β 6338:α 6326:γ 6321:β 6316:α 6299:γ 6289:α 6277:β 6272:α 6250:β 6245:α 6221:) 6219:4 6170:ε 6165:δ 6160:γ 6155:β 6150:α 6120:6 6115:5 6110:4 6105:3 6100:2 6095:1 6071:) 6069:4 6062:7 6057:6 6045:9 6040:5 6035:3 6030:2 6025:1 6008:X 6003:C 5998:B 5993:A 5963:2 5958:1 5854:L 5849:2 5844:1 5832:7 5827:6 5822:5 5817:4 5812:3 5807:2 5802:1 5777:4 5772:3 5767:2 5762:1 5745:9 5740:3 5735:2 5710:2 5705:1 5688:3 5683:2 5678:1 5666:3 5661:2 5656:1 5517:2 5512:1 5473:2 5468:1 5456:3 5451:2 5446:1 5434:2 5429:1 5385:2 5380:1 5337:) 5333:( 5314:3 5309:2 5304:1 5267:2 5255:K 5250:G 5245:F 5240:B 5193:3 5188:1 5176:ζ 5171:ε 5166:δ 5161:γ 5156:β 5151:α 5129:2 5124:1 5065:7 5060:6 5055:5 5050:4 5045:3 5040:2 5035:1 5018:) 5014:( 4972:e 4965:t 4958:v 4886:. 4874:: 4857:. 4830:. 4797:. 4777:: 4754:. 4742:: 4734:: 4711:. 4687:: 4681:5 4651:. 4631:: 4625:9 4608:. 4586:: 4559:. 4547:: 4524:. 4493:: 4466:. 4446:: 4440:5 4423:. 4409:: 4382:. 4360:: 4333:. 4311:: 4305:1 4281:. 4269:: 4263:3 4246:. 4232:: 4205:. 4183:: 4156:. 4142:: 4115:. 4093:: 4066:. 4052:: 4025:. 4003:: 3976:. 3954:: 3927:. 3905:: 3878:. 3864:: 3837:. 3817:: 3794:. 3782:: 3759:. 3739:: 3731:: 3708:. 3688:: 3664:. 3642:: 3634:: 3607:. 3593:: 3583:: 3577:4 3556:. 3536:: 3530:2 3513:. 3491:: 3461:. 3441:: 3435:6 3418:. 3394:: 3386:: 3380:2 3359:. 3327:: 3319:: 3292:. 3250:. 3230:: 3207:. 3185:: 3158:. 3136:: 3109:. 3079:. 3050:. 3019:: 2992:. 2972:: 2948:. 2924:: 2916:: 2889:. 2869:: 2861:: 2838:. 2809:. 2787:: 2781:2 2760:. 2748:: 2725:. 2713:: 2678:. 2649:. 2637:: 2614:. 2602:: 2576:. 2554:: 2522:. 2510:: 2388:; 2179:/ 2049:5 2041:4 2037:3 2033:2 2029:1 1984:; 1933:; 1876:; 1861:; 1117:.

Index


Antennapedia
Drosophila melanogaster
DNA
Pfam
PF00046
Pfam
CL0123
InterPro
IPR001356
SMART
SM00389
PROSITE
PDOC00027
SCOP2
1ahd
SCOPe
SUPFAM
Pfam
structures
ECOD
PDB
RCSB PDB
PDBe
PDBj
PDBsum
structure summary
PDB
1ahd
1akh

Text is available under the Creative Commons Attribution-ShareAlike License. Additional terms may apply.